DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and SHOX

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_000442.1 Gene:SHOX / 6473 HGNCID:10853 Length:292 Species:Homo sapiens


Alignment Length:68 Identity:37/68 - (54%)
Similarity:50/68 - (73%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ 398
            |....::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||
Human   111 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 175

  Fly   399 KRE 401
            :.:
Human   176 ENQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 33/55 (60%)
SHOXNP_000442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..119 1/7 (14%)
Homeodomain 118..174 CDD:459649 33/55 (60%)
SH3-binding. /evidence=ECO:0000255 242..249
OAR 272..288 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 274..287
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.