DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gsc and SHOX

DIOPT Version :9

Sequence 1:	NP_001137762.2	Gene:	Gsc / 33240	FlyBaseID:	FBgn0010323	Length:	473	Species:	Drosophila melanogaster
Sequence 2:	NP_000442.1	Gene:	SHOX / 6473	HGNCID:	10853	Length:	292	Species:	Homo sapiens

Alignment Length:	68	Identity:	37/68 - (54%)
Similarity:	50/68 - (73%)	Gaps:	0/68 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   334 GPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ 398
            |....::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||
Human   111 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 175

  Fly   399 KRE 401
            :.:
Human   176 ENQ 178

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gsc	NP_001137762.2	Homeobox	343..396	CDD:278475	31/52 (60%)
SHOX	NP_000442.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..34
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..119		1/7 (14%)
		Homeobox	120..174	CDD:395001	31/53 (58%)
		SH3-binding. /evidence=ECO:0000255	242..249
		OAR	272..288	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	274..287
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000011
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.940