powered by:
Protein Alignment: Gsc and SHOX
Sequence 1: | NP_001137762.2 |
Gene: | Gsc |
FlyBaseID: | FBgn0010323 |
Length: | 473 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_000442.1 |
Gene: | SHOX |
HGNCID: | 10853 |
Length: | 292 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 37/69 (54%) |
Similarity: | 50/69 (72%) |
Gaps: | 0/69 (0%) |
Fly 334 GPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ 398
|....::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||
Human 111 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 175
Fly 399 KRE 401
:.:
Human 176 ENQ 178
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
|
avgDist |
Average_Evolutionary_Distance |
R6207 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.