DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and gsc

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001016704.1 Gene:gsc XenbaseID:XB-GENE-486771 Length:243 Species:Xenopus tropicalis

Alignment Length:228 Identity:84/229 (37%)
Similarity:108/229 (47%) Gaps:27/229 (12%)


  Fly   227 SPIRPQRVPAMLQHPGLHLGHLAAAAASGF---AASPSDFLVA-------YPNFYPNYMH----- 276
            |.:.||..|.:....|..|  ...|..|||   |.:|:..|.|       :.|:|...:|     
 Frog    21 SVLLPQNGPMVFSSLGESL--YGPADYSGFYNRAVAPTSTLQAVTGSRLGFNNYYYGQLHVQTPM 83

  Fly   277 ----AAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPP 337
                ..||..:...|........|...:|....|..||....:.::|.....:..|.:..|   .
 Frog    84 GPSCCGAVQSLGTQQCSCVPPATAYDGAGSVLMPPVPHQMLPYMNVGTLSRTELQLLNQLH---C 145

  Fly   338 KRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKR-- 400
            :||||||||||:||||.||..|.:|.||||..|||||.:|.|:||:|||||||||||||:|||  
 Frog   146 RRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKVEVWFKNRRAKWRRQKRSS 210

  Fly   401 -EEQERLRKLQEEQCGSTTNGTTNSSSGTTSST 432
             ||.|..:|..:....||..|.....|...|.:
 Frog   211 SEESENTQKWNKSSKNSTEKGDEQVKSDLDSDS 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 39/53 (74%)
gscNP_001016704.1 Homeobox 151..204 CDD:278475 39/53 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003147
OrthoInspector 1 1.000 T1058822
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6207
TreeFam 1 0.960
43.990

Return to query results.
Submit another query.