DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and Awh

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster

Alignment Length:77 Identity:27/78 (35%)
Similarity:42/78 (54%) Gaps:0/78 (0%)


  Fly   332 GHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWR 396
            |.|....:.:|.||.||||||:.|:|.|.....||....|::|....|.:...:|||:|.||:.:
  Fly   140 GDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQK 204

  Fly   397 KQKREEQERLRK 408
            |.....:.::|:
  Fly   205 KHIHAGKNKIRE 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 22/53 (42%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6207
11.030

Return to query results.
Submit another query.