DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and Vsx2

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster

Alignment Length:311 Identity:99/312 (32%)
Similarity:129/312 (41%) Gaps:97/312 (31%)


  Fly   162 SLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSN-----SS 221
            |.|.|..:||........||:..:           |:.|.::..:|.....|.:.|:.     :|
  Fly     5 SPFAIQELLGLAVAAATEAPTDLT-----------TTAGATVAKERQTPTPPKTTNATMATAATS 58

  Fly   222 SSAAASPI-----------RPQRVPAMLQHPGLHLGH------------LAAAAASGFAASPSDF 263
            ::.||:|.           .||:.|...|....|  |            :..||||..|...:..
  Fly    59 AATAATPTNAAEGNLTSVSEPQQQPQQQQQEQQH--HQPHHHQYREHHQMTMAAASRMAYFNAHA 121

  Fly   264 LVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHG--------------HPH 314
            .|| ..|.|:.: ||||.|....|.|.|..          ||||||||              |||
  Fly   122 AVA-AAFMPHQL-AAAVHHHHQHQHQHHPH----------HHPHHPHGAVGGPPPPPPMQHHHPH 174

  Fly   315 HPH--------------------------LGAHHHGQHHLSHLGHGP---PPKRKRRH-RTIFTE 349
            |||                          |.....|...|:..|.||   ..|:|||| |||||.
  Fly   175 HPHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTS 239

  Fly   350 EQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKR 400
            .|||:||..|.:.|||||..||.|:||.:|.|:|::|||:||||||||.::
  Fly   240 YQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEK 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 34/54 (63%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 33/53 (62%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124287346
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.