DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and Pitx1

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 MGIID:107374 Length:315 Species:Mus musculus

Alignment Length:237 Identity:68/238 (29%)
Similarity:91/238 (38%) Gaps:75/238 (32%)


  Fly   229 IRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVS 293
            :||...|.....|..||..         ||.|.:.|       .|....::.|.:...:......
Mouse    17 LRPPPPPPHDMGPSFHLAR---------AADPREPL-------ENSASESSDADLPDKERGGEAK 65

  Fly   294 G---AAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQL 355
            |   ..||.:|.|.....|                         ...|::||.||.||.:||::|
Mouse    66 GPEDGGAGSAGCGGGAEDP-------------------------AKKKKQRRQRTHFTSQQLQEL 105

  Fly   356 EATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNG 420
            ||||.:..|||:.:||::|:..:|.|.||.||||||||||||::|.:|..|.|          .|
Mouse   106 EATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCK----------GG 160

  Fly   421 TTNSSSGTTSSTGNGSLTVKCPGSDHYSAQLVHIKSDPNGYS 462
            .....||...           |..|.|:|          |||
Mouse   161 YVPQFSGLVQ-----------PYEDVYAA----------GYS 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/53 (58%)
Pitx1NP_035227.1 Cnd2 48..>109 CDD:303063 20/86 (23%)
Homeobox 94..146 CDD:278475 31/52 (60%)
Interaction with PIT-1 151..280 13/63 (21%)
Forkhead_N 204..>275 CDD:254796
OAR 277..294 CDD:281777
OAR. {ECO:0000255|PROSITE-ProRule:PRU00138} 281..294
Nuclear localization signal. {ECO:0000255} 287..291
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6207
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.