DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gsc and ceh-45

Sequence 1:NP_001137762.2 Gene:Gsc FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_490823.1 Gene:ceh-45 WormBaseID:WBGene00022837 Length:229 Species:Caenorhabditis elegans

Alignment Length:252 Identity:87/253 (34%)
Similarity:122/253 (48%) Gaps:66/253 (26%)


  Fly   215 SPNSNSSSSAAASPIRPQ--RVPAMLQH-----PGLH-----LGHLAAAAASGFAASPSDFLVAY 267
            :|||.|.||:::||....  .:..:|.:     |.||     .|.:.||||:  :|.|..|   :
 Worm    18 TPNSASISSSSSSPSTSTSFSIDTLLSNPLAGIPQLHNFQDPFGAVGAAAAA--SALPWQF---H 77

  Fly   268 PNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLG 332
            |..||.:                      :.|.|    |..|      |.:..:|| ||:.|   
 Worm    78 PANYPFF----------------------SMLCG----PLMP------PFMAPYHH-QHYAS--- 106

  Fly   333 HGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
                 :|||||||||:||||..||.||..|||||...||:||::..||||||||||||||||.||
 Worm   107 -----RRKRRHRTIFSEEQLNILETTFSTTHYPDATTREELAVQCSLKEERVEVWFKNRRAKERK 166

  Fly   398 QKREEQERLRKL-QEEQCGSTTNGT-------TNSSSGTTSSTGNGSLTVKCPGSDH 446
            ||:::....:.. .:.:|..:...|       ..:|||..:|:.....::|...|::
 Worm   167 QKKDDSRTSKHSGDDSECDESDEDTRKVKRIKRENSSGKETSSPESKASLKTSHSEN 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 38/53 (72%)
ceh-45NP_490823.1 Homeobox 112..165 CDD:278475 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130747401
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T474328
orthoMCL 1 0.900 OOG5_134691
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6207
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.