DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and DMBX1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001374705.1 Gene:DMBX1 / 127343 HGNCID:19026 Length:382 Species:Homo sapiens


Alignment Length:200 Identity:70/200 - (35%)
Similarity:104/200 - (52%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 GLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG----------------HGPPPK 338
            |::|:..|..:.....::.|..|....||        |...|.                :|...:
Human     5 GVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHR 69

  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE-E 402
            ::||.||.||.:|||.||.||.||||||||:||:||:..:|.|.||:|||||||||:||::|. :
Human    70 KQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQ 134

  Fly   403 QERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSD-----HYS-AQLVHIKSDPNGY 461
            :|:|:| |:|..||  :|...:.:.|..:..:.....:.||||     |.| ::....:|.|...
Human   135 KEQLQK-QKEAEGS--HGEGKAEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQ 196

  Fly   462 SDADE 466
            .|.:|
Human   197 PDREE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 36/52 (69%)
DMBX1NP_001374705.1 Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 1..156 59/153 (39%)
Homeobox 74..128 CDD:395001 36/53 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..252 20/76 (26%)
OAR 357..373 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 359..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 1 1.000 - - X6207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.