Sequence 1: | NP_001137762.2 | Gene: | Gsc / 33240 | FlyBaseID: | FBgn0010323 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001374705.1 | Gene: | DMBX1 / 127343 | HGNCID: | 19026 | Length: | 382 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 70/200 - (35%) |
---|---|---|---|
Similarity: | 104/200 - (52%) | Gaps: | 34/200 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 GLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG----------------HGPPPK 338
Fly 339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE-E 402
Fly 403 QERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSD-----HYS-AQLVHIKSDPNGY 461
Fly 462 SDADE 466 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsc | NP_001137762.2 | Homeobox | 343..396 | CDD:278475 | 36/52 (69%) |
DMBX1 | NP_001374705.1 | Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 | 1..156 | 59/153 (39%) | |
Homeobox | 74..128 | CDD:395001 | 36/53 (68%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 128..252 | 20/76 (26%) | |||
OAR | 357..373 | CDD:397759 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 359..372 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 1 | 1.000 | - | - | X6207 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |