DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rempA and ift140

DIOPT Version :8

Sequence 1:NP_995608.1 Gene:rempA / 33230 FlyBaseID:FBgn0260933 Length:1503 Species:Drosophila melanogaster
Sequence 2:XP_021329488.1 Gene:ift140 / 553213 ZFINID:ZDB-GENE-040724-165 Length:1458 Species:Danio rerio

Alignment Length:1582 Identity:519/1583 (33%)
Similarity:815/1583 (51%) Gaps:210/1583 (13%)


  Fly     1 MTLYFDTKIEFLDSDAVSTISSWHPSEPLFAVASFSPERGGSVTIFADTGEPQRDVTYPVHATSQ 65
            |.:|||.:.|..||..|..:.|||.|..:.||.|.:|..||.|.::...|| ..::.: |.....
Zfish     1 MAVYFDHRAEAPDSSGVPVLISWHSSVCVLAVGSVNPSTGGCVDLYLQQGE-HVELCH-VERGFS 63

  Fly    66 ATALCWHPEKALLASGWEHGDIHVWFAGHREFASV-NAPHKAAIVLLQFSEQGGRMVTADAMGLV 129
            .:.|.|||.|.|||.|||.|:..:......|...: |..|.|.|.:|::|..|.|:||.|..|::
Zfish    64 PSLLQWHPNKPLLAVGWETGETILLSHPSGEHTPLPNNTHTACITVLEWSSNGSRLVTGDQAGVM 128

  Fly   130 TGWRCD--GQYQFLTMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGDENALDTLTNWRP 192
            ..|:.|  |:.|...:..||....|....||   .....|::|.||:|||:||||||| :.||:.
Zfish   129 AVWKVDARGKLQGSPLIKHDYSRPLTCCIFR---PPPPAEDVAMLARAAVSGDENALD-MFNWKK 189

  Fly   193 RTAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACVEVMKCGSLPPIVQMLWH-PRKDAVICLM 256
            .:...:.. .|.::...||..|..|.||.:::....|.::   |:...|..:|: .|:.|:..:.
Zfish   190 SSKGAAFA-LGSQEGLAFYISTADGSVYSVDEQVKSVPLL---SVESAVHKMWYSKRRSALAVVT 250

  Fly   257 EDLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWS-GNSLAIITGDFFVRIWDIERSDNYLL 320
            :.|.::.|.:...|...|:.:||:||| ||....:.|: |..|...:|:..:|:|.:|..|:|.|
Zfish   251 DSLQLSQFSLGPEGFAQEISKVKLSGR-GGPNADVVWTEGGLLITASGELHIRLWHVELDDHYAL 314

  Fly   321 KMDLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSSTGQT 385
            .:|                               ||.|..:         ||...|:::.::.|.
Zfish   315 SLD-------------------------------ESLGFEK---------GERLNCVSFCTSKQV 339

  Fly   386 LCAGTSQGNVYTWKR-SGSRLVGAPEDAWQLTNISSVRGAIRSCEWGYNELAKPCMLVNC-LSNV 448
            |.||||:|.|..|.. :.|...|..:..|:|...:.|.|.|...:||    :...:|..| .|:|
Zfish   340 LAAGTSRGRVALWHMLTVSDQKGDSKTQWKLQTPAEVEGNISQLQWG----SSAHLLAVCSSSSV 400

  Fly   449 FMLKEQPLLAVHTRELWAVQRSAKSVQLTHCSGREAIV-QSEFAVTAMALSELSLVMSNGRSISS 512
            .:|.|..:.:.:::::.|||.:...:.|.:.:....|. .::..:.|:.|::..:.:.||:.|:.
Zfish   401 VILSEHVMCSHYSQQMAAVQLTPTQLSLANFTSNTHITFNTDTHIRAVQLTKNMVAVWNGKMITV 465

  Fly   513 YSLQKVEKSLDEFEEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDVF 577
            |                   |.:..|..||         .:|..|..||.|..:||:.:..:.|.
Zfish   466 Y-------------------EPSGQTLHST---------GSFQCESPALALHEENIYTIEPNRVQ 502

  Fly   578 VYSVGGVVLHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFDD 642
            :.:..|.|...:..|:.||....:.:.|.||:|.|...:::.:|::|.:.|.|..:|:..::..|
Zfish   503 IRTPQGTVKQLLVFSEAEGNPTLLSVCGSYLAVGTDTCHIRVFDLTRREAKPLGVTKNLSELISD 567

  Fly   643 FGEFILVKCNSSGSHLAMVIASSNFTPISTLFCWDFERSNLLEYGLL------EPE-------TN 694
            .|....||||:|||.::::|...|..|.:.::.:|.|...|..:...      .||       :.
Zfish   568 LGALRSVKCNASGSQISVLITQINGRPDNRVYFYDIELDTLSYFDFFTGRPQSSPEQSEDSQRSR 632

  Fly   695 AKKESSTSLPVRIFWDAEEPRLLATEVKS-------------------------------MIQKT 728
            .::|.:...||..|||..||||...|..|                               ::|.:
Zfish   633 CEEELAARCPVSQFWDENEPRLFVCETVSVNSDLHGSRQRQTEKEDVMVVTFFVTQEHGLLLQDS 697

  Fly   729 LPQKNSL-------QPSHFVQSK-------VVLLFYSEKGCLNVLETQSMSPGCQLLNLCVPNVI 779
            .|:..:|       .|.::...|       |||.:..|.|....:.:.|.:.|.....:.|    
Zfish   698 QPKPAALLGLLALDTPYYYYICKLLFRRGCVVLPYLGESGDQGSVVSSSSAQGSSSPQMVV---- 758

  Fly   780 RLKINTMEEQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLAKMCV 844
                    .|.|:|||.|:.|...||..:||||.|:..|:||.|:::|:.|:|:.:|.|:|:|||
Zfish   759 --------RQALRDFVGLEGCEKQTRDAMLNFSFYLTIGDMDEAFKAIKLIKSEAVWENMARMCV 815

  Fly   845 HTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLYRRCKRFDLL 909
            .:.|||||:||:|::..||:.||||.|  :.:.|.||:|||||.:|||:|:|:.||:.|.|||||
Zfish   816 KSRRLDVARVCLGNMGNARAARALRDA--EKEPEVEAQVAVLATQLGMLEDAEQLYKSCGRFDLL 878

  Fly   910 NKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQELRERGDIKGALEYFEKTQNPAQNITQLLLE 974
            ||..|:.|...:|||.||..|||||:.|||..|:.|...||...||.||||:......:.::|:|
Zfish   879 NKFYQAAGQWQQAVETAETHDRIHLRTTYYSYAKHLEAMGDKNLALVYFEKSDTHRFEVPRMLME 943

  Fly   975 NPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFSQVKILCYLGKISKADAIAR 1039
            :..:::.||....|..|.||||.|:||..||:|||..|..|:|:.|||::.||||.|.||..||.
Zfish   944 DNVSLEIYINKMKDKDLYKWWGHYLESQSDMEAALHYYDLAQDYLSQVRVHCYLGSIQKASEIAN 1008

  Fly  1040 QSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRICKENDFQEELWTVASSSRQRDKAIA 1104
            ::|:|||.||:||.||...:..:::.|:||||.::||||:||||:..::|..:|..|...|....
Zfish  1009 ETGNRAASYHVARQYEGQDEISQSVHFYTRAQAYNNAIRLCKENNLDDQLMNLALLSNPEDMIDT 1073

  Fly  1105 AAYFEECG-NFKHAVELYHRAGMLHKALEMAFESQQPEILEIIASDLAPDSDAELINRCADFFCS 1168
            |.|:||.| :...||.|||:||.:.||||:||.::|...|::||.||...||..|:.||:|||..
Zfish  1074 AMYYEEKGTHMDRAVMLYHKAGHVSKALELAFATEQFGALQLIAEDLNEASDPALLARCSDFFIK 1138

  Fly  1169 IEQFQKAVHLLAKTRHLERALGICSEKGVPVTEELSEMLTPEKGE--FEEATRVHILVQLGEFLQ 1231
            ..|:||||.||...:....||.:|.::.:.:||:|:|.||..|..  ..||.|..:|.::.:...
Zfish  1139 HAQYQKAVELLVAAKKYHEALQLCLDQSLTITEDLAESLTVPKDSTLLSEAGRKELLEKIADCCM 1203

  Fly  1232 QQGDYHSATKKFTQAGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQV 1296
            :||:||.||||:||||:||:||::|||||:|:||:|||.:|||:|:|:|||||||:|||::|.::
Zfish  1204 RQGNYHLATKKYTQAGNKIKAMRALLKSGDTEKIVFFAGVSRQKEIYVMAANYLQSLDWRNDAEI 1268

  Fly  1297 LKHIVTFYTKGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKL-----SHAQHVYN 1356
            :|:|::|||||:|.:.||.||..||::||:::|:|.||..|:.||.|||.|.     ..|.....
Zfish  1269 MKNIISFYTKGRALELLAGFYEACAEVEIDDYQNYEKAYGALTEACKCLTKAKGRSGEEADGKLL 1333

  Fly  1357 NLQRTVADVKAILEIQQALREGDHQLVIGSCRSMLIKPELP-PIRHAHILAMLIRALVYVKDYSE 1420
            .|...:..:|..::.:: :.|.|....:..|.|:|.:.:|. .:|...:...|:....:..::::
Zfish  1334 ILTHRLGLIKRFIQARR-MHEEDPVEAVRLCESLLEEKDLDLAVRVGDVFGFLVEHYCHHGNFTQ 1397

  Fly  1421 AGRALKELTVKDSTWSASGLLDRSIVHKIAQECHLEFDLIWNAGRQVTASTSGTAATGMSSTSGM 1485
            |...::||              ||...||                .::...|.|:...:.:.:|:
Zfish  1398 AWSKIEEL--------------RSTHPKI----------------NLSMYVSQTSLEALQNAAGI 1432

  Fly  1486 ------TTTDDDDADDEEITEE 1501
                  |.|...| ||||:.|:
Zfish  1433 RLVYKETNTHAAD-DDEEVEED 1453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rempANP_995608.1 WD40 <14..123 CDD:295369 39/110 (35%)
WD40 repeat 67..103 CDD:293791 14/37 (38%)
WD40 71..480 CDD:225201 118/416 (28%)
WD40 repeat 108..144 CDD:293791 13/38 (34%)
WD40 repeat 153..202 CDD:293791 18/49 (37%)
WD40 repeat 222..276 CDD:293791 10/55 (18%)
WD40 repeat 288..312 CDD:293791 6/25 (24%)
TPR 860..1070 CDD:223533 101/210 (48%)
BRO1_Alix_like <901..1110 CDD:301330 96/209 (46%)
TPR repeat 937..973 CDD:276809 14/36 (39%)
TPR repeat 988..1039 CDD:276809 29/51 (57%)
TPR repeat 1044..1070 CDD:276809 12/26 (46%)
ift140XP_021329488.1 ANAPC4_WD40 <67..115 CDD:315554 19/48 (40%)
WD40 103..>398 CDD:225201 97/348 (28%)
WD40 repeat 107..147 CDD:293791 13/40 (33%)
WD40 repeat 195..231 CDD:293791 9/40 (23%)
WD40 repeat 239..321 CDD:293791 26/114 (23%)
WD40 repeat 328..371 CDD:293791 14/43 (33%)
tRNA_int_end_N2 439..505 CDD:315583 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22532815
eggNOG 1 0.900 E1_KOG3617
Hieranoid 1 1.000
Homologene 1 1.000 H40979
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D149441at33208
OrthoFinder 1 1.000 FOG0005918
OrthoInspector 1 1.000 T1052502
orthoMCL 1 0.900 OOG5_130315
Panther 1 1.100 LDO PTHR15722
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.