DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rempA and che-11

DIOPT Version :8

Sequence 1:NP_995608.1 Gene:rempA / 33230 FlyBaseID:FBgn0260933 Length:1503 Species:Drosophila melanogaster
Sequence 2:NP_506047.5 Gene:che-11 / 179666 WormBaseID:WBGene00000490 Length:1437 Species:Caenorhabditis elegans

Alignment Length:1542 Identity:397/1543 (26%)
Similarity:703/1543 (46%) Gaps:261/1543 (17%)


  Fly    35 FSPERGGSVTIFADTGEPQRDVTYPVHATS----------QATALCWHPEKALLASGWEHGDIHV 89
            ::|..|....:..|....:.:|.:..|:.|          ..:.:.|||:|..:..||:.|.:..
 Worm     8 WAPHCGWICVVTQDETTGEANVAFSDHSGSVQEKGPSKPGSVSCVRWHPKKQFVVVGWKDGGVCF 72

  Fly    90 WFAGHREFASVNAPHKAAIVLLQFSEQGGRMVTADAMGLVTGWRCDGQ-------------YQFL 141
            ...|.      |..| ..:....|..||            ..|..||.             |.::
 Worm    73 IPKGG------NVSH-TVVETYPFPNQG------------VDWSHDGTVLMTLHNPSSVHLYSYM 118

  Fly   142 ---------TMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGDENALD-----TLTNWRP 192
                     .:...:|.:.:.|.|.||:.:.      ...:|.:|..|::.:|     :..:...
 Worm   119 VIGEEISTSNIMQIELNDQITLWCKRLSYDK------FKPSKISVTDDDSGVDESPFGSKESLAE 177

  Fly   193 RTAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACV------EVMKCGSLPPIVQMLWHPRKDA 251
            |...:|....|..    |....:.|.:|.::......      |::..|....|         ..
 Worm   178 RRDEKSTVPKGTE----FLFAGKSGTIYGVDNDRQRTIHKLDSEILFMGYCETI---------SI 229

  Fly   252 VICLMEDLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWSGNSLAIITGDFFVRIWDIERSD 316
            :|....|..: ..|.:.|..:...:|||:...|...:..:......|.:..|:..:|:||:.:.:
 Worm   230 IIVFTRDCFI-FHLAKGTSEMRCAERVKVKLGGKSEKYSLELDDGILVMCYGEKEIRVWDLIKEE 293

  Fly   317 NYLLKMDLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSS 381
            |..:.:|:..|.||..::..::                              :||:.        
 Worm   294 NGTIALDVNKGFQPDETINVVT------------------------------VNGKR-------- 320

  Fly   382 TGQTLCAGTSQGNVYTWKRSGSRLVGAPEDAWQLTNISSVRGAIRSCEWGYNELAKPCMLVNCLS 446
              ..:.|.||..|:..|||  .|.....|.||.|:..:.|...:....|.           ..||
 Worm   321 --GVITAATSLNNIAEWKR--KRTDTNVESAWNLSPSTHVDSQVSLIRWS-----------PILS 370

  Fly   447 NVFMLKEQPLLAVHTRELW--------AVQRSAKSVQLTHCSG--REAIVQSEFAVTAMALSELS 501
            ...::.|:.|:.:....|.        |:|.|:.|..|.|.:.  .:.:..|..:...:.|.|..
 Worm   371 TAALITEEDLVLIGENSLTVKMRGKMAAIQTSSNSFTLLHATSGVSQDLKLSIPSAKGICLGEKQ 435

  Fly   502 LVMSNGRSISSYSLQKVEKSLDEFEEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQ 566
            ||:.|..::.:|.:|          ..|.|::.|                 :|:....::.:.||
 Worm   436 LVVWNEDTVVTYDVQ----------TSLATIQCT-----------------SFSCNTTSVAIVNQ 473

  Fly   567 NIFCLGSSDVFVYSVGGVVLHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLF 631
            |::|:....:|..::.|.:...|...:|||....::::.|:::|.|.||:::.|::|..|.:...
 Worm   474 NLYCIEKDKIFARTLQGTLRQEISLPEIEGDPEILEVNRCWMAVATTNGFIRIYNLSAKDAQQEH 538

  Fly   632 PSKSGHDIFDDFGEFILVKCNSSGSHLAMVIASSNFTPISTLFCWD----------FER--SNLL 684
            .||...:...:|.:|..::.|.:|:.:|:.......|....|..:|          |:|  ::..
 Worm   539 NSKYIIENVKNFYKFHTIRINHTGNKVAVSYLEDVSTVAERLLVYDAELDAVSYFSFDRGMTDTQ 603

  Fly   685 EYGLLEPETNAK-KESSTSLPV----------------------RIFWDAEEPRLLATEVKSMIQ 726
            ||     ||.|: ..:|:..||                      ...||..:.|.|..|.     
 Worm   604 EY-----ETQAELAHTSSGRPVTAAARKMAREQSRFQMMNHRPGAFEWDENDARYLVVEC----- 658

  Fly   727 KTLPQKNSLQPSHFVQSKVVLLFYSEKGC-LNVLETQSMSPGCQLLNLCVPNVIRLKINTMEEQP 790
                  ..::|....|..:.....||.|. |..::.:::..| :|:::.|||...::.:..:|:.
 Worm   659 ------IHVEPESTDQRVLTAFVTSEHGIQLQGMQQKNLHCG-KLVSVSVPNFYFVRKSGWDEED 716

  Fly   791 ---------------LQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLA 840
                           |::|:..:.|:..|||.:::||.|:..|:||.|:::|:.|:|..:|.::|
 Worm   717 NRDERTIGKTLVAKCLREFLGNENCDESTRKAMMDFSFYLTIGSMDAAFKAIQFIKSDSVWDHMA 781

  Fly   841 KMCVHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLYRRCKR 905
            .|.:.|.|||||.||:||::..|..||:|::.::.:.:: .|.|.|||||.|:|||..:|.:.:|
 Worm   782 SMSIKTRRLDVAMVCLGHMKNVRGARAVRRSQQNGENDS-MKCAALAIELSMLEEALIIYAQNER 845

  Fly   906 FDLLNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQEL---RERGDIKGALEYFEKTQNPAQN 967
            :||:|||.||......|.|:||.:|||||::|:|..|:.|   |::..|:.|:|.:||....|..
 Worm   846 YDLMNKLYQSQNMWSSAFEIAETKDRIHLRNTHYNYAKYLEARRDQASIEAAIENYEKAGVHAFE 910

  Fly   968 ITQLLLENPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFSQVKILCYLGKIS 1032
            :.::|.:.|..:::|::...:..|..|||.|:||.|:::.|::.|..|:|::..|::.|..||..
 Worm   911 VFRMLKDYPKQIEQYVRRKREESLYSWWGAYLESVGELEGAISFYSSAKDYYCMVRVKCIQGKTD 975

  Fly  1033 KADAIARQSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRICKENDFQEELWTVASSSR 1097
            :|..:|.:|.|:||||.:.|.|||.|...:|:.|||:|:..|:|||:.||:|.::.|..:...:.
 Worm   976 EAARLAEESKDKAACYLIGRMYENDGDVVKAVKFFTKARALSSAIRLAKEHDMKDRLANLCLMAG 1040

  Fly  1098 QRDKAIAAAYFEECGNFKH-AVELYHRAGMLHKALEMAFESQQPEILEIIASDLAPDSDAELINR 1161
            ..:...||.|:|:...:.| ||.|||:|||:.:||::||.::|...|::|..||...:|.:::.|
 Worm  1041 GSELVSAARYYEDLPGYAHKAVMLYHKAGMIGRALDLAFRTEQFSALDLITKDLDAGTDPKILRR 1105

  Fly  1162 CADFFCSIEQFQKAVHLLAKTRHLERALGICSEKGVPVTEELSEMLTPEKGEFEEA-TRVHILVQ 1225
            .|:||.:.:.::|||:.|...:....|:.:|..:.|.|:::.:|::||.|.:.... .|..:|..
 Worm  1106 AAEFFENNQNYEKAVNFLCLAKEFSGAVQLCKNRNVRVSDKFAELMTPTKDDMPNVQERKQVLET 1170

  Fly  1226 LGEFLQQQGDYHSATKKFTQAGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDW 1290
            :.|...|||.|.:|.|||||||||:.||::|||||:..||.||||.:|.:|:||:|||:||..||
 Worm  1171 VAELCLQQGAYSAAAKKFTQAGDKLSAMRALLKSGDIQKIRFFANTARNKEIYILAANFLQTTDW 1235

  Fly  1291 QSDPQVLKHIVTFYTKGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVY 1355
            |.:.|.:|.|.|||||.|:|:.|.|||...|.||.|..:...|::.|::.|:.|:.:........
 Worm  1236 QDNQQTMKDIETFYTKSQSFEHLGNFYKSVAIIEAEHLRTLDKSMGALEMAAVCVLEAEQKNMST 1300

  Fly  1356 NNLQRTVADVK----------AILEI-QQALREGDHQLVIGSCRSMLIKPELPPIRHAHILAMLI 1409
            ..|.....|:|          ::||: :....:|..||...:..|  |..::.|.  ..:.|::|
 Worm  1301 TGLDALKEDLKKYVVQLRKLQSVLEVMKNDAADGMRQLTTLAEES--IDDDIVPC--TRLFALII 1361

  Fly  1410 RALVYVKDYSEAGRALKELTVKDSTWSASGLLDRSIVHKIAQECHLE 1456
            ......|::..|.||:..|..|.........::.|.:.|:..|..:|
 Worm  1362 EDHASRKNWKPAYRAITGLQKKVPNVDLETFVETSTLDKVCDEMRME 1408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rempANP_995608.1 WD40 <14..123 CDD:295369 19/98 (19%)
WD40 repeat 67..103 CDD:293791 9/36 (25%)
WD40 71..480 CDD:225201 80/450 (18%)
WD40 repeat 108..144 CDD:293791 7/58 (12%)
WD40 repeat 153..202 CDD:293791 10/54 (19%)
WD40 repeat 222..276 CDD:293791 7/60 (12%)
WD40 repeat 288..312 CDD:293791 5/24 (21%)
TPR 860..1070 CDD:223533 80/213 (38%)
BRO1_Alix_like <901..1110 CDD:301330 77/212 (36%)
TPR repeat 937..973 CDD:276809 12/39 (31%)
TPR repeat 988..1039 CDD:276809 18/51 (35%)
TPR repeat 1044..1070 CDD:276809 13/26 (50%)
che-11NP_506047.5 TPR 841..1053 CDD:223861 77/212 (36%)
TPR repeat 934..960 CDD:276809 11/26 (42%)
TPR repeat 987..1013 CDD:276809 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22532627
eggNOG 1 0.900 E1_KOG3617
Hieranoid 1 1.000
Homologene 1 1.000 H40979
Inparanoid 1 1.050 519 1.000 Inparanoid score I685
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D149441at33208
OrthoFinder 1 1.000 FOG0005918
OrthoInspector 1 1.000 T476206
orthoMCL 1 0.900 OOG5_130315
Panther 1 1.100 LDO PTHR15722
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3605
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.