DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rempA and Ift140

DIOPT Version :8

Sequence 1:NP_995608.1 Gene:rempA / 33230 FlyBaseID:FBgn0260933 Length:1503 Species:Drosophila melanogaster
Sequence 2:XP_006246116.1 Gene:Ift140 / 100362124 RGDID:2318759 Length:1475 Species:Rattus norvegicus

Alignment Length:1528 Identity:521/1528 - (34%)
Similarity:822/1528 - (53%) Gaps:167/1528 - (10%)


  Fly     1 MTLYFDTKIEFLDSDAVSTISSWHPSEPLFAVASFSPERGGSVTIFADTGEPQRDVTYPVHATSQ 65
            |.||||.:|:..|:.:..:..:|||:.|..||||.||..||:|.|:.:.|||..|.  .:..:.|
  Rat     1 MALYFDHRIKAPDASSSPSHITWHPTHPFLAVASVSPSSGGNVDIYLEQGEPVPDT--HIERSFQ 63

  Fly    66 ATALCWHPEKALLASGWEHGDIHVWFAGHREFASVNAPHKAAIVLLQFSEQGGRMVTADAMGLVT 130
            ||:|||||.:.:||.|||.|::.::....:|..:|..||...|.:|.:|..|..:|:.|.:|::.
  Rat    64 ATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTTDIAILSWSTSGSCLVSGDKLGVLL 128

  Fly   131 GWRCD--GQYQFLTMFSHDLREVLLLICFRLTVESEVREEMANLAKAAVAGDENALDTLTNWRPR 193
            .||.|  |:.|...:..|:..:.|....|||....   |::..||||||:|||.||| :.||| :
  Rat   129 LWRLDQRGRVQGTPLLKHEYGKPLTHCIFRLPPPG---EDLVQLAKAAVSGDEKALD-MFNWR-K 188

  Fly   194 TAARSMTHSGVRDNHCFYACTQGGVVYYINQGGACVEVMKCGSLPPIVQMLWH-PRKDAVICLME 257
            ::..|...:|.::...|:.....|.|:|:::.|...:|   .|....:|.|:: .:::|::.:.:
  Rat   189 SSFGSFLKTGSQEGLSFFVSLMDGTVHYVDEKGKTAQV---ASTDSSIQTLFYIEKREALVVVTQ 250

  Fly   258 DLTVTLFLVESTGILTELDRVKMSGRGGGRQGGIAWSGNSLAIITGDFFVRIWDIERSDNYLLKM 322
            :|.::|::|...|...|:.:||:||:.|.|.......|:.|....|:..:|.||:||.:||:|.:
  Rat   251 NLLLSLYVVNPEGEAEEVMKVKLSGKTGRRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSL 315

  Fly   323 DLPSGNQPGSSMTTLSNGTMSSSNQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSSTGQTLC 387
            .                                        .|:|...||....:.|......|.
  Rat   316 Q----------------------------------------EKFGFEKGENINSVCYCKAKGLLA 340

  Fly   388 AGTSQGNVYTWKR-----SGSRLVGAPEDAWQLTNISSVRGAIRSCEWGYNELAKPCMLVNCLSN 447
            |||.:|.|..||:     ||....|  :|.|.|...:.:.|.|...:||..   |..:.|:...:
  Rat   341 AGTHKGRVAMWKKVPVSPSGRGAEG--KDMWALQTPTELEGNITQIKWGSR---KNLLAVSTSDS 400

  Fly   448 VFMLKEQPLLAVHTRELWAVQRSAKSVQLTHCS-GREAIVQSEFAVTAMALSELSLVMSNGRSIS 511
            |.:|.||.:.:...:::.|||.|...|.::..| |....::::..::.:..::.::.:.||:.::
  Rat   401 VSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGSTHSLRTDMHISGVFATKDAVAVWNGKQVA 465

  Fly   512 SYSLQKVEKSLDEFEEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDV 576
            .:     |.|            |:|           |:...||..|...|.:..::|:.:..:.:
  Rat   466 IF-----EPS------------GST-----------LRNAGTFLCETSVLAMHEESIYTVEPNRL 502

  Fly   577 FVYSVGGVVLHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFD 641
            .|.:..|.|...:..|:.||....:|:.|.:|...|...:.|::|:||.:.|:....|:...:..
  Rat   503 QVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQMIP 567

  Fly   642 DFGEFILVKCNSSGSHLAMVIASSNFTPISTLFCWDFERS--NLLEY-----GLL------EPET 693
            |.|....::||::|:.::::::..:.:|.|.::.:|.|..  |:..:     |.:      ||.|
  Rat   568 DVGSITSLRCNANGNKISILLSKVDNSPDSKIYVYDVEMDTVNVFNFKTGHIGQIQTLPFNEPPT 632

  Fly   694 NA----KKESSTS-LPVRIFWDAEEPRLLATEVKSMIQKTLPQKNSLQPSHFVQSK------VVL 747
            |.    ..||..| :||..|||..||||...|.........||....|| |..:..      ::|
  Rat   633 NEAHFFMNESLASYVPVNHFWDQSEPRLFVCEALQEAPGAQPQAIDKQP-HMEEGTCHKEEVLIL 696

  Fly   748 LFYS--EKGCLNVLETQSMSPGC--QLLNLCVPNVIRLK-------------------------- 782
            .|::  |.|.|  |......|..  .||.|.||:....|                          
  Rat   697 SFFASEEHGFL--LHDSFPRPSTYQSLLGLEVPHYYFTKKLLFHRRGVYDAVPGEADKEDKMDSG 759

  Fly   783 ----INTMEEQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYRSIRSIQSKVIWTNLAKMC 843
                ...:.::||:|||.|:.|:..||..:||||.:|..|:||.|::||:.|:|:.:|.|:|:||
  Rat   760 HYHIPQMVAKKPLRDFVGLEDCDKPTRDAMLNFSFFVTIGDMDEAFKSIKLIKSETVWENMARMC 824

  Fly   844 VHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAVLAIELGMIEEAKDLYRRCKRFDL 908
            |.|.||||||||:|::..||..||||:|..:.:|  ||:||:|||:|||:|||:.||::|||:||
  Rat   825 VKTQRLDVAKVCLGNMGHARGARALREAEREPEL--EARVAMLAIQLGMLEEAEQLYKKCKRYDL 887

  Fly   909 LNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQELRERGDIKGALEYFEKTQNPAQNITQLLL 973
            |||..|:.....:|||:||..||:||:.|||..|:.|....|...||.|:||:......:.::|.
  Rat   888 LNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGLALSYYEKSDTHRFEVPRMLS 952

  Fly   974 ENPGAMKRYIQTTSDPKLLKWWGQYIESSGDMDAALAVYHKAEDWFSQVKILCYLGKISKADAIA 1038
            |:..:::.||....|..|.:||.||:||..:||.||..|..|:|:||.|:|.|:.|.|.||..||
  Rat   953 EDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIA 1017

  Fly  1039 RQSGDRAACYHLARHYENVGKFQEAIMFFTRAQTFSNAIRICKENDFQEELWTVASSSRQRDKAI 1103
            .::||.||.|||||.||:..:.::|:.|:||||.|:||||:||||...::|..:|..|...|...
  Rat  1018 NETGDWAASYHLARQYESQDEVKQAVHFYTRAQAFNNAIRLCKENGLDDQLMNLALLSSPEDMIE 1082

  Fly  1104 AAAYFEECG-NFKHAVELYHRAGMLHKALEMAFESQQPEILEIIASDLAPDSDAELINRCADFFC 1167
            ||.|:||.| ....||.|||:||...||||:||.:||...|::||.||...||..|:.||:||..
  Rat  1083 AARYYEEKGEQMDRAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCI 1147

  Fly  1168 SIEQFQKAVHLLAKTRHLERALGICSEKGVPVTEELSEMLTPEKG--EFEEATRVHILVQLGEFL 1230
            ...||:|||.||...:....||.:|.|:.:.:|||::|.:|..|.  :..|.:|..:|.|:....
  Rat  1148 EHRQFEKAVELLLAAKKYHEALQLCLEQNMTITEEMAEKMTVSKDSKDLSEESRRELLEQIANCC 1212

  Fly  1231 QQQGDYHSATKKFTQAGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQ 1295
            .:||:||.||||:||||:|::||::|||||:|:||:|||.:|||:|:|||||||||:|||:.:|:
  Rat  1213 MRQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKEPE 1277

  Fly  1296 VLKHIVTFYTKGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVYN---- 1356
            ::|:|::|||||:|.|.||.||..|||:||:|:|:|.||..|:.||.|||.| :.|::..:    
  Rat  1278 IMKNIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSK-AKAKNPLDQETK 1341

  Fly  1357 --NLQRTVADVKAILEIQQALREGDHQLVIGSCRSMLIKPEL-PPIRHAHILAMLIRALVYVKDY 1418
              .||..:..||..::.::...| |.:..:..|..:|.:|:| ..||...|...|:...|.:::|
  Rat  1342 LAQLQSKMTLVKRFIQARRTYTE-DPKESVRQCELLLEEPDLDSTIRVGDIYGFLVEHHVQMEEY 1405

  Fly  1419 SEAGRALKELTVKDSTWSASGLLDRSIVHKIAQ 1451
            ..|.:.|:|:..:..:.:.|..:|:..|..:.|
  Rat  1406 QMAYKYLEEMRKRLPSANMSYYVDQRTVDTVHQ 1438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rempANP_995608.1 WD40 <14..123 CDD:295369 41/108 (38%)
WD40 repeat 67..103 CDD:293791 14/35 (40%)
WD40 71..480 CDD:225201 114/416 (27%)
WD40 repeat 108..144 CDD:293791 12/37 (32%)
WD40 repeat 153..202 CDD:293791 20/48 (42%)
WD40 repeat 222..276 CDD:293791 11/54 (20%)
WD40 repeat 288..312 CDD:293791 5/23 (22%)
TPR 860..1070 CDD:223533 96/209 (46%)
BRO1_Alix_like <901..1110 CDD:301330 92/208 (44%)
TPR repeat 937..973 CDD:276809 11/35 (31%)
TPR repeat 988..1039 CDD:276809 25/50 (50%)
TPR repeat 1044..1070 CDD:276809 12/25 (48%)
Ift140XP_006246116.1 WD40 <15..139 CDD:295369 47/125 (38%)
WD40 repeat 19..57 CDD:293791 18/39 (46%)
WD40 repeat 64..101 CDD:293791 15/36 (42%)
WD40 86..437 CDD:225201 107/403 (27%)
WD40 repeat 108..160 CDD:293791 15/51 (29%)
tRNA_int_end_N2 <455..506 CDD:289680 13/78 (17%)
TPR 844..1104 CDD:223533 122/261 (47%)
TPR repeat 909..939 CDD:276809 13/29 (45%)
TPR repeat 970..996 CDD:276809 13/25 (52%)
TPR repeat 1023..1049 CDD:276809 12/25 (48%)
Nic96 <1059..1240 CDD:282017 78/180 (43%)
RNase_H_like 1179..>1294 CDD:301345 61/114 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22534415
eggNOG 1 0.900 E1_KOG3617
Hieranoid 1 1.000
Homologene 1 1.000 H40979
Inparanoid 1 1.050 819 1.000 Inparanoid score I434
OMA 1 1.010
OrthoDB 1 1.010 D149441at33208
OrthoFinder 1 1.000 FOG0005918
OrthoInspector 1 1.000 T1086781
orthoMCL 1 0.900 OOG5_130315
Panther 1 1.100 LDO PTHR15722
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.