DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and RPA135

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_015335.1 Gene:RPA135 SGDID:S000006214 Length:1203 Species:Saccharomyces cerevisiae

Alignment Length:1176 Identity:492/1177 (42%)
Similarity:705/1177 (60%) Gaps:106/1177 (9%)


  Fly    38 PHVDSFDEMLTVGLD----------------------NSAKHMIPNHWLSPAGEKISMKVESIWI 80
            ||:.||: .||.|.|                      ||...:..:.:|   |.|:|:.||.:.|
Yeast    44 PHIGSFN-ALTEGPDGGLLNLGVKDIGEKVIFDGKPLNSEDEISNSGYL---GNKLSVSVEQVSI 104

  Fly    81 AKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINM-DLGEVPIMLRSKA 144
            |||.....|.....|::||::|||...||.|...::|.||||..::....: |.|.:|:||:|..
Yeast   105 AKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNR 169

  Fly   145 CNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGM 209
            |:|.:.:|.|:|:|.|...|.||.|::.|.||::||||:.|||||:.:.|.|:.:||.::|..|:
Yeast   170 CHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGI 234

  Fly   210 LVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESD 274
            .:::||.|::|.:||:||||:|...|.||..|....|||.:|||.|...:|.||::.::.....|
Yeast   235 QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKD 299

  Fly   275 QYYVSCVQAMLREVQNENVYTHAQCKS----FIGNLFRARFPEVPEWQPDDDVTDFILRERVMIH 335
            .:....::.:||..:..  |.|.|.::    ::|:.||..|...|: |.|.:|...:|...|::|
Yeast   300 SFLTDRLELLLRGFKKR--YPHLQNRTQVLQYLGDKFRVVFQASPD-QSDLEVGQEVLDRIVLVH 361

  Fly   336 L--DTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESW----VS 394
            |  |..:|||::::|||:||:....|:...:|.|:...|||||.|.||...|.|:::.:    ::
Yeast   362 LGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNIIA 426

  Fly   395 QVRRCLQK--KLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMA 457
            |||..:.:  .:...|....|.|:   ||....:|..::.||:|||:.|::||.|.|.||..::|
Yeast   427 QVRMDINRGMAINFKDKRYMSRVL---MRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVA 488

  Fly   458 ENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISM 522
            |.||..|::||||.:||||:|..::||..|:|||::|||:||||||||:|||||||....|.||.
Yeast   489 EKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRIST 553

  Fly   523 RPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGT 587
            :...  |..||..|..:|:.|.|:....|..|..|.:|||.:|.:...:.:.|.|.|||.|:.|.
Yeast   554 QQSD--VSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGK 616

  Fly   588 LPQM---MEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEM 649
            .|.:   :|||::|....||:||||:..|.:||:|||..|...:.:.:|..||:||.||:..:|:
Yeast   617 TPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEI 681

  Fly   650 YPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQT 714
            ..:..||:|...|:.:|.||||.|..|:||||||||||||||||||||.:....::.||||||||
Yeast   682 QNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQT 746

  Fly   715 PGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTL 779
            ..||:.:...||:..:|:|..|.||:|||||||||||:|||||||:|.||||.||::|||:.:.|
Yeast   747 GQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDL 811

  Fly   780 -------DKKSSYFA-RHPHMP-ELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDE 835
                   |..:.:|. .:...| |.::.||.||||:.|:.:..|.|:..|||..:...|:.....
Yeast   812 ALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHS 876

  Fly   836 KEDCIVESIRQLGSFDLSPK----KMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFT 896
            .|...:|.:..:|  |.|.|    :.|:|..|:.|...|||||:||.||||:||:|:|..|:||:
Yeast   877 SEPAYIEEVNLIG--DESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFS 939

  Fly   897 ESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGG 961
            |:|:.|||:.|||.|||||||.|.:|::|||..|:||...|:||:.|:|::|..||||:.|...|
Yeast   940 ETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAG 1004

  Fly   962 YNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGV 1026
            |||:|.|.:|||..|.|:.|||:.|||:||||||||.||:||||||.|.:.|.||:|||||.||:
Yeast  1005 YNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGI 1069

  Fly  1027 RFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCR 1091
            |.|||||||||.||.:|||||||.::||.|...||.:|||||...|.:.:   .|.:|:.  .||
Yeast  1070 RVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPR---IGSISTV--CCR 1129

  Fly  1092 LCG---------------------DNSSV---------------SMIEIPFSFKYLVTELSSVNI 1120
            .|.                     |:|.:               :.:.|||..|||.:|||::.|
Yeast  1130 RCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGI 1194

  Fly  1121 NARFKL 1126
            ..|:.:
Yeast  1195 RLRYNV 1200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 492/1177 (42%)
RNA_pol_B_RPB2 35..1125 CDD:238353 492/1174 (42%)
RNA_pol_Rpa2_4 564..614 CDD:284335 20/53 (38%)
RPA135NP_015335.1 RpoB 23..1203 CDD:223163 492/1177 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56237105
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 872 1.000 Inparanoid score I46
Isobase 1 0.950 0 Normalized mean entropy S774
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1135680
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1173
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.