DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and RET1

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_014850.1 Gene:RET1 SGDID:S000005733 Length:1149 Species:Saccharomyces cerevisiae

Alignment Length:1207 Identity:336/1208 (28%)
Similarity:531/1208 (44%) Gaps:205/1208 (17%)


  Fly    19 PEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDN--SAKHMIPNHWLSPAGEKISMKVESIWIA 81
            |.|.::...:.:||        |||:..:...|..  .|..:|    ||....:..:|...|.:.
Yeast    49 PAFLKVKGLVKQHL--------DSFNYFVDTDLKKIIKANQLI----LSDVDPEFYLKYVDIRVG 101

  Fly    82 KPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKACN 146
            | |......|..|.   |.:.|...::||....|.:.::.........::::|.:||||||..|.
Yeast   102 K-KSSSSTKDYLTP---PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCI 162

  Fly   147 LGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLV 211
            |..|...:|.|..|...:.||.|::.|.||::.:.....:|. |.|:....|         |:: 
Yeast   163 LYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNR-IIVEADEKK---------GIV- 216

  Fly   212 QTVREDESSLSNVVH------YLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQG 270
                  ::|:::..|      |:.....|....|......:|:.::||.....:|.||. :||.|
Yeast   217 ------QASVTSSTHERKSKTYVITKNGKIYLKHNSIAEEIPIAIVLKACGILSDLEIM-QLVCG 274

  Fly   271 YESDQYYVSCVQAMLREVQNENVYTHAQCKSFIG----NLFRARFPEVPEWQPDDDVTDFILRE- 330
              :|..|.......|.|....::||..|...:||    .:.|.:..              ||:| 
Yeast   275 --NDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAKVKTMRRQKLT--------------ILQEG 323

  Fly   331 ------RVMIHLDT----YEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYL 385
                  .|:.||..    :.:|...|..|.:::.........:::.|....:.:.|.|.|.....
Yeast   324 IEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLF 388

  Fly   386 SERVESWVSQVRRCLQKKLTSP------DALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTG 444
            .:..:.:.:..:..:.|.|..|      |||::..|.:..:  ..|:.|||    :|||.:.:. 
Yeast   389 EDLFKKFNNDFKLSIDKVLKKPNRAMEYDALLSINVHSNNI--TSGLNRAI----STGNWSLKR- 446

  Fly   445 LGLMQNSGLVIMAENINRMRYMSHFRAIHR-GSYFTTMRTTEA-RQLLPDAWGFICPVHTPDGTP 507
             ..|:.:|:..:   ::|:.|:|....:.| .|.|...|.... |.|.|..:|.:|...||:|..
Yeast   447 -FKMERAGVTHV---LSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEA 507

  Fly   508 CGLLNHLTLTCEISMRPDPKLVKAI-------PKHLIDMGMMPLSNRRYLGEKLYVVFLDGKHLG 565
            |||:.:|.|...|:...:.:.:|.:       ...|||...:.|:         |.|:|:|..:|
Yeast   508 CGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLN---------YGVYLNGTLIG 563

  Fly   566 HIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVW-------- 622
            .|.  ...|.|.:.|:.:..|.:.:     ||....|.....::|||...|:.||:.        
Yeast   564 SIR--FPTKFVTQFRHLRRTGKVSE-----FISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSR 621

  Fly   623 ------------------NLKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLA 669
                              .||...|||:...|:....||:..|::.|.. ||||:.....:..:|
Yeast   622 VKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSM-THLEIEPFTILGAVA 685

  Fly   670 NLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFA 734
            .|||.|.:||||||.|||.||||.:|....|..|:....||.:..|..|:.:....:.|..|...
Yeast   686 GLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVKTKTIELIDYDKLP 750

  Fly   735 MGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYFARHP-HMPELI-- 796
            .|.||.|||:||:|||:|||:::||::.:|||.       :..|..|.::...|:. |..::|  
Yeast   751 AGQNATVAVMSYSGYDIEDALVLNKSSIDRGFG-------RCETRRKTTTVLKRYANHTQDIIGG 808

  Fly   797 -------------KHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKV---------VKMDEKEDC 839
                         :.|..|||...|.|:..|.   .|.:..|.|...         |:...:|..
Yeast   809 MRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQ---IYINKSVPTNSADAPNPNNVNVQTQYREAP 870

  Fly   840 IV------ESIRQ-LGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTE 897
            ::      ..|.| :.|...:.:.::.:.||..|...:||||:||.||||:|......||:||.:
Yeast   871 VIYRGPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFND 935

  Fly   898 SGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGY 962
            .|::|||:.||||||||||:..|||.::||...::|.:...|.|..|:    ::...|:|...|:
Yeast   936 QGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSK----LEDMSKILVDQGF 996

  Fly   963 NYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVR 1027
            ||.|.:.||||:.|..:.|.||||.::||:|:|||.||...|:.|.....|.||.:||.|.||:|
Yeast   997 NYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLR 1061

  Fly  1028 FGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRL 1092
            .||||||.:|::||:.||.:||..:||.....||.||                 ||......|..
Yeast  1062 LGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKC-----------------GLMGYSGWCTT 1109

  Fly  1093 CGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLNEI 1129
            |....::..:.||::.|.|..||.|:||..|.:|.:|
Yeast  1110 CKSAENIIKMTIPYAAKLLFQELLSMNIAPRLRLEDI 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 331/1190 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 330/1186 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 12/50 (24%)
RET1NP_014850.1 RpoB 26..1147 CDD:223163 336/1208 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.