DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and RPB2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_014794.3 Gene:RPB2 SGDID:S000005677 Length:1224 Species:Saccharomyces cerevisiae

Alignment Length:1307 Identity:354/1308 (27%)
Similarity:559/1308 (43%) Gaps:362/1308 (28%)


  Fly    40 VDSFDEML------------TVGLDNSAKHMIPNHWLSPAGEKISMKVE----SIWIAKPKVPQD 88
            :|||::.:            |:.|:..|:|       :...:.||.|.|    .|::.||.|.:.
Yeast    48 LDSFNQFVDYTLQDIICEDSTLILEQLAQH-------TTESDNISRKYEISFGKIYVTKPMVNES 105

  Fly    89 VIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMD--------------------- 132
              |..|..:||.::|..:::||.      |..|:..::|...:|                     
Yeast   106 --DGVTHALYPQEARLRNLTYSS------GLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSES 162

  Fly   133 ----LGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVK 193
                :|.:|||||||.|.|.:||..::.|..|...:.||.|:|.|:||::           |..:
Yeast   163 GKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVL-----------IAQE 216

  Fly   194 RSSWKDRGQNFSDLGMLVQT-----------VREDESSLSNVVHYLNN-------------GTAK 234
            ||:           |.:||.           |.|..|:|.....:::.             .|.|
Yeast   217 RSA-----------GNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIK 270

  Fly   235 FMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRL---VQGYESDQYYVSCVQAMLREVQNENVYTH 296
            ....::|:  .:|:.:|.:.|....|.||...:   |..::..:....||:      ....:...
Yeast   271 ATLPYIKQ--DIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVE------DGFVIQDR 327

  Fly   297 AQCKSFIGNLFRA---RFPEVPEWQPDDDVTDFILRERVMIHLDTYED----KFQLIVFMIQKLF 354
            .....|||....|   :..:..::..|      ||::..:.|:...|.    |...:.:||.:|.
Yeast   328 ETALDFIGRRGTALGIKKEKRIQYAKD------ILQKEFLPHITQLEGFESRKAFFLGYMINRLL 386

  Fly   355 QCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLT-------------- 405
            .||..:...::.|....:.:.|.|.|            ::|:.:.|.||||              
Yeast   387 LCALDRKDQDDRDHFGKKRLDLAGPL------------LAQLFKTLFKKLTKDIFRYMQRTVEEA 439

  Fly   406 ---SPDALVTSAVMTQCMRQAGGVGRAIESFLATGN-------IASRTGLGLMQNSGLVIMAENI 460
               :....:.:..:|..::.|          |||||       ::||.|           :::.:
Yeast   440 HDFNMKLAINAKTITSGLKYA----------LATGNWGEQKKAMSSRAG-----------VSQVL 483

  Fly   461 NRMRY---MSHFR----AIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTC 518
            ||..|   :||.|    .|.|..     :..:.|||....||.:||..||:|..|||:.:|:|..
Yeast   484 NRYTYSSTLSHLRRTNTPIGRDG-----KLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMS 543

  Fly   519 EISMRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKLYV---------VFLDGKHLGHIHQSEAEK 574
            .||:..||   ..|...|.:.||.||.:        ||         ||::|...| :|::.| :
Yeast   544 CISVGTDP---MPIITFLSEWGMEPLED--------YVPHQSPDATRVFVNGVWHG-VHRNPA-R 595

  Fly   575 IVDELRYGKIFGTL-PQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVW-----------NLKWK 627
            :::.||..:..|.: |::..|..|..|:      |.|.|...|:.||::           .||.:
Yeast   596 LMETLRTLRRKGDINPEVSMIRDIREKE------LKIFTDAGRVYRPLFIVEDDESLGHKELKVR 654

  Fly   628 R----------------------------------VEYIGTLEQLYMEIAIDAKEMYP------- 651
            :                                  ||||...|:..:.||:..:::.|       
Yeast   655 KGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEN 719

  Fly   652 DFT----------------THLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLN 700
            |..                ||.|:..:..:...|::||.||:||||||.||..||||.||....|
Yeast   720 DLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTN 784

  Fly   701 WPKQ---AANKLYRLQTP-GTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAA 761
            :..:   .||.||..|.| ||.  |.:.|  ::..:...|.|||||:..|:||:.||:||:|:::
Yeast   785 YNVRMDTMANILYYPQKPLGTT--RAMEY--LKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSS 845

  Fly   762 YERGFAYGSIYKTKFLTLDKK-----SSYFARHPHMPEL-IKH-----LDTDGLPHPGSKLSYGS 815
            .:||. :.|::...::..:||     :..|.:......| :||     ||.|||..||.::|   
Yeast   846 IDRGL-FRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVS--- 906

  Fly   816 PLYCYFDGE---VATYKVVKMDEK---------------------EDCIVESIRQLGSFDLSPKK 856
                   ||   :.....:..||:                     |:.||:.:  |.:.:....|
Yeast   907 -------GEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQV--LVTTNQDGLK 962

  Fly   857 MVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMI 921
            .|.:.:|..:...||||||||.||||.....|..||:|||..|::||::.|||..|||||:|.:|
Yeast   963 FVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLI 1027

  Fly   922 ETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFG 986
            |.:..|.||:.||..||:||    .:..::...|:|...||...|.|.:|:|..|:::.|.||||
Yeast  1028 ECLLSKVAALSGNEGDASPF----TDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFG 1088

  Fly   987 VVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFH 1051
            ..:||||||||.||...|:.|.::..|.||::||.|.||:||||||||.:|:||||..|::||..
Yeast  1089 PTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLME 1153

  Fly  1052 NSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELS 1116
            .||.....:|..||     |..::.:     |:.....|:.|.:...:..|.||::.|.|..||.
Yeast  1154 ASDAFRVHICGICG-----LMTVIAK-----LNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELM 1208

  Fly  1117 SVNINAR 1123
            ::||..|
Yeast  1209 AMNITPR 1215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 354/1308 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 354/1308 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 13/51 (25%)
RPB2NP_014794.3 RNA_pol_Rpb2_7 31..1216 CDD:331952 354/1308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.