DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and POLR1B

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001269701.1 Gene:POLR1B HGNCID:20454 Length:1173 Species:Homo sapiens

Alignment Length:1138 Identity:514/1139 (45%)
Similarity:720/1139 (63%) Gaps:49/1139 (4%)


  Fly    17 SRPEFKQ-------IPKKLSR-HLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISM 73
            |.|..|.       ||::..: .|..|...||:||:..:..|| ..|...||....:...|:||.
Human    50 SGPSLKHLTDPSYGIPREQQKAALQELTRAHVESFNYAVHEGL-GLAVQAIPPFEFAFKDERISF 113

  Fly    74 KVESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPI 138
            .:....|:.|.||:..| .:...:||.:.|....:|.|..:..:.|:|||:.|..|...||.|||
Human   114 TILDAVISPPTVPKGTI-CKEANVYPAECRGRRSTYRGKLTADINWAVNGISKGIIKQFLGYVPI 177

  Fly   139 MLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQN 203
            |::||.|||....|:.:::|.|...|.||.|:|.|.||::|||||.|||.||.:.|..||.||..
Human   178 MVKSKLCNLRNLPPQALIEHHEEAEEMGGYFIINGIEKVIRMLIMPRRNFPIAMIRPKWKTRGPG 242

  Fly   204 FSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLV 268
            ::..|:.:..|||:.|:::..:|||.|||....|.:.|.|.::|:...||.|:.::|.:|:..|:
Human   243 YTQYGVSMHCVREEHSAVNMNLHYLENGTVMLNFIYRKELFFLPLGFALKALVSFSDYQIFQELI 307

  Fly   269 QGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVM 333
            :|.|.|.:..:.|..|||.|..|...|..|..:::|..||.:. .||:|.|::...:|:..:.:.
Human   308 KGKEDDSFLRNSVSQMLRIVMEEGCSTQKQVLNYLGECFRVKL-NVPDWYPNEQAAEFLFNQCIC 371

  Fly   334 IHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRR 398
            |||.:..:||.::..|.:|||..|:|:...:|.||.:.||||.||.|:..:|.|::|.|:..::.
Human   372 IHLKSNTEKFYMLCLMTRKLFALAKGECMEDNPDSLVNQEVLTPGQLFLMFLKEKLEGWLVSIKI 436

  Fly   399 CLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRM 463
            ...||.......:.:..:.:.......:.:..|...||||:.|:|||||:|:|||.::|:.:|.:
Human   437 AFDKKAQKTSVSMNTDNLMRIFTMGIDLTKPFEYLFATGNLRSKTGLGLLQDSGLCVVADKLNFI 501

  Fly   464 RYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKL 528
            ||:||||.:|||:.|..||||..|:|||::|||:||||||||.||||:||||..||:..:  ...
Human   502 RYLSHFRCVHRGADFAKMRTTTVRRLLPESWGFLCPVHTPDGEPCGLMNHLTAVCEVVTQ--FVY 564

  Fly   529 VKAIPKHLIDMGMMPLS---NRRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIF--GTL 588
            ..:||..|.::|:.|:.   :|.|  .:.|.|.|||..:|.:.:..|..|.|.||:.|:.  ..:
Human   565 TASIPALLCNLGVTPIDGAPHRSY--SECYPVLLDGVMVGWVDKDLAPGIADSLRHFKVLREKRI 627

  Fly   589 PQMMEIGFIPFK-KNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMYPD 652
            |..||:..||.. |...:|||::.|.|.|::|||.||...:.|.|||:||::|.:||...|::..
Human   628 PPWMEVVLIPMTGKPSLYPGLFLFTTPCRLVRPVQNLALGKEELIGTMEQIFMNVAIFEDEVFAG 692

  Fly   653 FTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGT 717
            .|||.||.....:|.:||.||..|:||||||||||||||||||.|.|.:..::.|||||||||.:
Human   693 VTTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQS 757

  Fly   718 PLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKK 782
            ||.||..||...:|::.:|||||||||||||||||||||:|||::|||||:||:||::|:.|.:|
Human   758 PLVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFIDLSEK 822

  Fly   783 ------SSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKEDCIV 841
                  |..|...|..|.:::.||.||||..|:||.||.|.|.|.:.......|:....||:|:|
Human   823 IKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMYYKSKENCVV 887

  Fly   842 ESIRQLGSFDLSPK-KMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIV 905
            ::|:...:...|.| |.|.||:||||..|||||||||.|||||.|:.:||||:||||||::|||:
Human   888 DNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMVPDIL 952

  Fly   906 FNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERL 970
            ||||||||||||.|:||:||||.||:||..:|||||.|||||:|::|||:||:|.|||:||||||
Human   953 FNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALEYFGEMLKAAGYNFYGTERL 1017

  Fly   971 YSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDA 1035
            |||:.|.|:.||||.|||:||||||||.||:|||:|||.:..|:|||.||...||:|||||||||
Human  1018 YSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDA 1082

  Fly  1036 LISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDT----------C 1090
            |::||.:|||.||||:.||::...||.||||:|:||           |...|.:          |
Human  1083 LLAHGTSFLLHDRLFNCSDRSVAHVCVKCGSLLSPL-----------LEKPPPSWSAMRNRKYNC 1136

  Fly  1091 RLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            .||..:.::..:.:|:.|:|.|.||:::||..:
Human  1137 TLCSRSDTIDTVSVPYVFRYFVAELAAMNIKVK 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 508/1114 (46%)
RNA_pol_B_RPB2 35..1125 CDD:238353 508/1113 (46%)
RNA_pol_Rpa2_4 564..614 CDD:284335 17/53 (32%)
POLR1BNP_001269701.1 RpoB 73..1172 CDD:223163 509/1116 (46%)
RNA_pol_B_RPB2 76..1171 CDD:238353 508/1113 (46%)
RNA_pol_Rpb2_2 224..413 CDD:282427 67/190 (35%)
RNA_pol_Rpa2_4 601..654 CDD:284335 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56219825
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 982 1.000 Inparanoid score I308
Isobase 1 0.950 0 Normalized mean entropy S774
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1072597
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.