DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and NRPA2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_564341.2 Gene:NRPA2 AraportID:AT1G29940 Length:1178 Species:Arabidopsis thaliana

Alignment Length:1205 Identity:465/1206 (39%)
Similarity:672/1206 (56%) Gaps:127/1206 (11%)


  Fly    10 TIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMK 74
            |:|.:    .:||:        |.||...|::|||.|...|||.....:.|.....|..|    .
plant     9 TVPTM----EDFKE--------LHNLVTHHIESFDYMTLKGLDVMFNRIKPVSVYDPNTE----N 57

  Fly    75 VESIWIAKPKV--PQD---VIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLG 134
            ..|||:..|.|  ||.   ....|...:.|.:.||..:||:|.....:.:..|.........|.|
plant    58 ELSIWLENPLVFAPQKESFKSTSRKEPLLPFECRQAKISYTGTFMADVCFKYNDGVVVRDKFDFG 122

  Fly   135 EVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKD 199
            :.||||.||.|:|..|...:::|..|..||.||.|::.|.|::.|.:|..:||||..:.|:|::|
plant   123 QFPIMLMSKLCSLKGADCRKLLKCKESTSEMGGYFILNGIERVFRCVIAPKRNHPTSMIRNSFRD 187

  Fly   200 RGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIY 264
            |.:.:|...::.:.||:|:||::..::||.||:|:..|..|.|...:||.|:||.|.:..|||||
plant   188 RKEGYSSKAVVTRCVRDDQSSVTVKLYYLRNGSARVGFWIVGREYLLPVGLVLKALTNSCDEEIY 252

  Fly   265 NRL----------VQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQP 319
            ..|          ..|....|......:.:|.||::..::|..||:..:|..|          ||
plant   253 ESLNCCYSEHYGRGDGAIGTQLVRERAKIILDEVRDLGLFTREQCRKHLGQHF----------QP 307

  Fly   320 DDD---------VTDFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVL 375
            ..|         |.:.:||:.:.:|||...|||.|::|:||||:.........:|.||...||:|
plant   308 VLDGVKKESLSIVAEAVLRDYLFVHLDNDHDKFNLLIFIIQKLYSLVDQTSLPDNPDSLQNQEIL 372

  Fly   376 LPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQAG-----GVGRAIESFLA 435
            :|||:...||.|::|.|:.:.:..|:.:|.:.::..:...:....:...     .:|.:||:.|.
plant   373 VPGHVITIYLKEKLEEWLRKCKSLLKDELDNTNSKFSFESLADVKKLINKNPPRSIGTSIETLLK 437

  Fly   436 TGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPV 500
            ||.:.:::||.|.|.:|..:.||.:|.:|::|.|||:|||:.|..:|||..|:|||::|||:|||
plant   438 TGALKTQSGLDLQQRAGYTVQAERLNFLRFLSFFRAVHRGASFAGLRTTTVRKLLPESWGFLCPV 502

  Fly   501 HTPDGTPCGLLNHLTLTCEISMRPDP--------KLVKAIPKHLIDMGMMPLSNR--RYLGEKLY 555
            |||||||||||||:|.|..|:.:.|.        |:.|::...|...||:|...:  |....|:.
plant   503 HTPDGTPCGLLNHMTRTSRITSQFDSKGNIRDFLKIRKSVVDVLTGAGMVPSLPKLVRAGPPKVI 567

  Fly   556 VVFLDGKHLGHIHQSEAEKIVDELRYGKIF--GTLPQMMEIGFIPFKKNGQFPGLYIATGPARMM 618
            .|.|||:.:|.:..:...|:|..:|..|:.  ..:|:.:|:|::|....|.:||||:|:.|||.:
plant   568 HVLLDGQVVGTLSSNLVTKVVSYIRRLKVEAPSVIPEDLEVGYVPTSMGGSYPGLYLASCPARFI 632

  Fly   619 RPVWNLK--WKRVEYIGTLEQLYMEIAIDAKEMYPD----------FTTHLELAKTHFMSNLANL 671
            |||.|:.  ...:|.||..||::|||:.      ||          ..||.|:..|..:|.:|||
plant   633 RPVKNISIPSDNIELIGPFEQVFMEISC------PDGGNGGRNNSSLATHEEIHPTGMISVVANL 691

  Fly   672 IPMPDYNQSPRNMYQCQMGKQTM--GTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFA 734
            .|..|:||||||||||||.||||  .|..|.:  :|..|:|.||||.:|:.|...|....:|:..
plant   692 TPWSDHNQSPRNMYQCQMAKQTMAYSTQALQF--RADQKIYHLQTPQSPVVRTKTYTTYSIDENP 754

  Fly   735 MGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTL-------DKKSSYFARHPHM 792
            .||||||||:::||:|||||||:||::.|||..:|.||:|:.:.|       |..|..|.|..:.
plant   755 TGTNAIVAVLAHTGFDMEDAMILNKSSVERGMCHGQIYQTENIDLSDQNSRFDSGSKSFRRSTNK 819

  Fly   793 PELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEK--EDCIVESIRQLGSFDLSPK 855
            .|..: :|.||||..|.|| |....||....|| |.|...|..|  :..||:.:    |.|:..|
plant   820 AEHFR-IDADGLPSVGQKL-YPDEPYCSIYDEV-TNKTRHMKRKGTDPVIVDFV----SVDMKSK 877

  Fly   856 K---MVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFT-ESGLIPDIVFNPHGFPSRMT 916
            |   ...|..|..|...|||||:||.||||:|||.:|..|:||. .:|:.||::.|||.||||||
plant   878 KHPQRANIRFRHARNPIIGDKFSSRHGQKGVCSQLWPDIDMPFNGVTGMRPDLIINPHAFPSRMT 942

  Fly   917 IAMMIETMAGKGAAIHGNVYDATPFR----------FSEENTAIDYFGKMLEAGGYNYYGTERLY 971
            |||::|::|.||.::||...||||||          .|:.:..:|..|.||:..|:|:||||.||
plant   943 IAMLLESIAAKGGSLHGKFVDATPFRDAVKKTNGEEESKSSLLVDDLGSMLKEKGFNHYGTETLY 1007

  Fly   972 SGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDAL 1036
            ||..|.|:..:||.|.|:||||||||.||:||||||.|:..|||||||||||||:||||||||:|
plant  1008 SGYLGVELKCEIFMGPVYYQRLRHMVSDKFQVRSTGQVDQLTHQPIKGRKRGGGIRFGEMERDSL 1072

  Fly  1037 ISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAP----LQRIVKRNETG----GLSSQPDTCRLC 1093
            ::|||::||.|||..:||.....||..|||:|..    :|:.....|.|    |.:.:..||..|
plant  1073 LAHGASYLLHDRLHTSSDHHIADVCSLCGSLLTSSVVNVQQKKLIQEIGKLPPGRTPKKVTCYSC 1137

  Fly  1094 GDNSSVSMIEIPFSFKYLVTELSSVNINARFKLNE 1128
            ..:..:..:.:|:.|:||..||:|:||....:|::
plant  1138 KTSKGMETVAMPYVFRYLAAELASMNIKMTLQLSD 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 460/1180 (39%)
RNA_pol_B_RPB2 35..1125 CDD:238353 458/1176 (39%)
RNA_pol_Rpa2_4 564..614 CDD:284335 15/52 (29%)
NRPA2NP_564341.2 RpoB 13..1174 CDD:223163 463/1202 (39%)
RNA_pol_B_RPB2 22..1169 CDD:238353 458/1176 (39%)
RNA_pol_Rpb2_2 202..372 CDD:282427 58/180 (32%)
RNA_pol_Rpa2_4 576..628 CDD:284335 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 754 1.000 Inparanoid score I103
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoInspector 1 1.000 T192886
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.