DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and Polr1b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_113961.1 Gene:Polr1b RGDID:620822 Length:1135 Species:Rattus norvegicus

Alignment Length:1172 Identity:503/1173 (43%)
Similarity:700/1173 (60%) Gaps:119/1173 (10%)


  Fly    19 PEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAKP 83
            |.:...|::....|.:|...|||||:..:..||.: |...||....:...|:||:.:....|:.|
  Rat    22 PSYAVPPEQQKAALQDLTRAHVDSFNYAVLEGLSH-AVQAIPPFEFAFKDERISLTIVDAAISPP 85

  Fly    84 KVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKACNLG 148
            .||:..| .:...|||.:.|....:|.|..:..:.|:||||.|..|...|| ||||::||.|||.
  Rat    86 AVPKGTI-CKELNIYPAECRGRRSTYRGKLTADISWAVNGVPKGIIKQFLGXVPIMVKSKLCNLY 149

  Fly   149 QATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQT 213
            ...|:.:::|.|...|.||.|:|.|.||::|||||.|||.||.:.|..||.||..::..|:.:..
  Rat   150 NLPPQVLIEHHEEAEEMGGYFIINGIEKVIRMLIMPRRNFPIAMIRPKWKSRGLGYTQFGVSIHC 214

  Fly   214 VREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESDQYYV 278
            |||:.|:::..:||:.|||....|.:.|.|.::|:...||.|:.::|.:|:..|::|.|.|.::.
  Rat   215 VREEHSAVNMNLHYVENGTVMLNFIYRKELFFLPLGFALKALVSFSDYQIFQELIKGKEEDSFFK 279

  Fly   279 SCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHLDTYEDKF 343
            :.|..|||.|..|..:|..|...::|..||.:. .:|:|.|:.:..:|:..:.:.|||.:..|||
  Rat   280 NSVSQMLRIVMEEGCHTQKQVLDYLGERFRVKL-SLPDWYPNAEAAEFLFNQCICIHLKSNTDKF 343

  Fly   344 QLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPD 408
            .|:..|.:|||..|:|:...:|.||.:.||||.||.|:..:|.|::|:|:..::..|.|:....:
  Rat   344 YLLCLMTRKLFALARGECMEDNPDSLVNQEVLTPGQLFLMFLKEKMENWLLSIKIALDKRAQKTN 408

  Fly   409 ALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIH 473
            ..:.:..:.:.......:.|..|..|||||:.|:||||.||:|||.::|:.:|.:||:||||.:|
  Rat   409 VSINNENLMKIFSMGTELTRPFEYLLATGNLRSKTGLGFMQDSGLCVVADKLNFIRYLSHFRCVH 473

  Fly   474 RGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKLV--KAIPKHL 536
            ||:.|..||||..|:|||::|||:||||||||.|||||||||..||:.    .|.|  .:||..|
  Rat   474 RGADFAKMRTTTVRKLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVV----TKFVYTASIPALL 534

  Fly   537 IDMGMMPLSN---RRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIF------------- 585
            ..:|:.|:..   |.|  ...|.|.|||..:|.:.:..|.::.|.||..|:.             
  Rat   535 CGLGVTPVDAAPCRPY--SDCYPVLLDGVMVGWVDKELAPEVADTLRRFKVLRERRCSSLDGGGP 597

  Fly   586 -------GTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLK--------------WKRV 629
                   ..:|:.     :|...:.| .|...|...|...|..||..              |...
  Rat   598 DSHDRKAKPVPRA-----VPLHHSLQ-AGEACAEPGAGQRRARWNYGAALHEHCHLRGRGFWWSF 656

  Fly   630 EYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTM 694
            ...|.|.....|:                         :||.||..|:|||||||||||||||||
  Rat   657 HTPGALPSQPAEV-------------------------IANFIPFSDHNQSPRNMYQCQMGKQTM 696

  Fly   695 GTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINK 759
            |.|.|.:..::.|||||||||.:||.||..||:..:|::.:|||||||||||||||||||||:||
  Rat   697 GFPLLTYQDRSDNKLYRLQTPQSPLVRPCMYDHYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNK 761

  Fly   760 AAYERGFAYGSIYKTKFLTLDKK------SSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLY 818
            |::|||||:||:||::|:.|.:|      |..|...|..|.:::.||.||||..|:||.:|.|.|
  Rat   762 ASWERGFAHGSVYKSEFIDLSEKFKQGDDSLVFGVKPGDPRVMQKLDNDGLPFIGAKLEFGDPYY 826

  Fly   819 CYF-----DGEVATYKVVKMDEKEDCIVESIRQLGSFDLSPK-KMVAITLRVPRPATIGDKFASR 877
            .|.     :|.|..||     .||:|:|::|:...:...|.| |.|.:|:||||..|||||||||
  Rat   827 GYLNLNTGEGFVVYYK-----SKENCVVDNIKVCSNDTGSGKFKCVCVTVRVPRNPTIGDKFASR 886

  Fly   878 AGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFR 942
            .|||||.|:.:||||:||||||::|||:||||||||||||.|:||:||||.||:||..:|||||.
  Rat   887 HGQKGILSRLWPAEDMPFTESGMMPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFI 951

  Fly   943 FSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTG 1007
            |||||:|::|||:||:|.|||:|||||||||:.|.|:.||||.|||:||||||||.||:|||:||
  Rat   952 FSEENSALEYFGEMLKAAGYNFYGTERLYSGISGMELEADIFIGVVYYQRLRHMVSDKFQVRTTG 1016

  Fly  1008 AVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQ 1072
            |.:..|:|||.||...||:||||||||||::||.:|||.||||:.||::...||.||||:|:|| 
  Rat  1017 ARDKVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVKCGSLLSPL- 1080

  Fly  1073 RIVKRNETGGLSSQPDT----------CRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLN 1127
                      |...|.:          |.:||.:.|:..:.:|:.|:|.|.||:::||  :.||:
  Rat  1081 ----------LEKPPPSWSAMRNRKYNCTVCGRSDSIDTVSVPYVFRYFVAELAAMNI--KVKLD 1133

  Fly  1128 EI 1129
            .|
  Rat  1134 VI 1135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 499/1155 (43%)
RNA_pol_B_RPB2 35..1125 CDD:238353 497/1151 (43%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/70 (16%)
Polr1bNP_113961.1 RpoB 35..1134 CDD:223163 500/1157 (43%)
RNA_pol_B_RPB2 38..1133 CDD:238353 499/1153 (43%)
RNA_pol_Rpb2_2 186..375 CDD:282427 67/190 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56222028
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 922 1.000 Inparanoid score I330
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1086255
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.