DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and NRPC2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001332060.1 Gene:NRPC2 AraportID:AT5G45140 Length:1161 Species:Arabidopsis thaliana

Alignment Length:1208 Identity:323/1209 (27%)
Similarity:534/1209 (44%) Gaps:166/1209 (14%)


  Fly    14 LTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVE-S 77
            :.::..:|:.:|:.|.  :..|...|:|||:..:.||:          |.:..|..:|:..|: |
plant    26 IKSTADKFQLVPEFLK--VRGLVKQHLDSFNYFINVGI----------HKIVKANSRITSTVDPS 78

  Fly    78 IWIAKPKV---PQDVIDVRTRE-IYPTDSRQLHVSYSGMCSVRL----GWSVNGVQKTPINMDLG 134
            |::...||   ...:|:|.|.| |.|...|...::|:....|.:    |...|..:....|:.:|
plant    79 IYLRFKKVRVGEPSIINVNTVENINPHMCRLADMTYAAPIFVNIEYVHGSHGNKAKSAKDNVIIG 143

  Fly   135 EVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKD 199
            .:||||||..|.|.....||:.:.||...:.||.|:|:|.||::.:.....:|..|.   .|.|.
plant   144 RMPIMLRSCRCVLHGKDEEELARLGECPLDPGGYFIIKGTEKVLLIQEQLSKNRIII---DSDKK 205

  Fly   200 RGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIY 264
            ...|.|.......|..:....:.....||      |:...||:   :|:.::||.:...:|:|| 
plant   206 GNINASVTSSTEMTKSKTVIQMEKEKIYL------FLHRFVKK---IPIIIVLKAMGMESDQEI- 260

  Fly   265 NRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQP--DDDVTDFI 327
               ||....|..:.:.:...:.|..:|.|.|..|...::    .|:..::....|  .|.....|
plant   261 ---VQMVGRDPRFSASLLPSIEECVSEGVNTQKQALDYL----EAKVKKISYGTPPEKDGRALSI 318

  Fly   328 LRERVMIHLDTYEDKFQLIVF----MIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSER 388
            ||:..:.|:...::.|:...|    |::::.:....|..:::.|....:.:.|.|.|......:.
plant   319 LRDLFLAHVPVPDNNFRQKCFYVGVMLRRMIEAMLNKDAMDDKDYVGNKRLELSGQLISLLFEDL 383

  Fly   389 VESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQAG--GVGRAIESFLATGNIASRTGLGLMQNS 451
            .::.:|:..:.:...|..| ...:....:||:.:..  .:...:|..|:|||...:.  ..|...
plant   384 FKTMLSEAIKNVDHILNKP-IRASRFDFSQCLNKDSRYSISLGLERTLSTGNFDIKR--FRMHRK 445

  Fly   452 GLVIMAENINRMRYMSHFRAIHRGS--YFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHL 514
            |   |.:.:.|:.::.....|.:.|  :..:.:.:..|.|.|..||.:||..||:|..|||:.:|
plant   446 G---MTQVLTRLSFIGSMGFITKISPQFEKSRKVSGPRSLQPSQWGMLCPCDTPEGESCGLVKNL 507

  Fly   515 TLTCEISMRPD--PKLVKAIPKHLIDMGMMPLSNRRYLGEKL-----YVVFLDGKHLGHIHQSEA 572
            .|...::...:  |.:.......:.|:.::.       .|:|     ::|.|:|..||  ..|..
plant   508 ALMTHVTTDEEEGPLVAMCYKLGVTDLEVLS-------AEELHTPDSFLVILNGLILG--KHSRP 563

  Fly   573 EKIVDELRYGKIFGTLPQMMEIG-FIPFKKNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLE 636
            :...:.||      .|.:..:|| |:....|.:...:|:|:...|:.||:....    :.|..::
plant   564 QYFANSLR------RLRRAGKIGEFVSVFTNEKQHCVYVASDVGRVCRPLVIAD----KGISRVK 618

  Fly   637 QLYMEIAIDAKEMYPDF----------------------------------------TTHLELAK 661
            |.:|:...|....:.||                                        |||:|:..
plant   619 QHHMKELQDGVRTFDDFIRDGLIEYLDVNEENNALIALYESDGTTELDEGAEAAKADTTHIEIEP 683

  Fly   662 THFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYD 726
            ...:..:|.|||.|.:||||||.|||.||||.||....|...:....||.|..|..||......:
plant   684 FTILGVVAGLIPYPHHNQSPRNTYQCAMGKQAMGNIAYNQLNRMDTLLYLLVYPQRPLLTTRTIE 748

  Fly   727 NIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYFARHPH 791
            .:..|....|.||.|||:|::|||:|||:::||::.:|||....:.|.......|..:..|....
plant   749 LVGYDKLGAGQNATVAVMSFSGYDIEDAIVMNKSSLDRGFGRCIVMKKIVAMSQKYDNCTADRIL 813

  Fly   792 MP-------ELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKM---------------- 833
            :|       |.::.||.|||..||..:   .|...|.:.:|....|.|.                
plant   814 IPQRTGPDAEKMQILDDDGLATPGEII---RPNDIYINKQVPVDTVTKFTSALSDSQYRPAREYF 875

  Fly   834 --DEKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFT 896
              .|.|..:|:.:....  |...:..:...:|..|...:||||:||.||||:|......||.||:
plant   876 KGPEGETQVVDRVALCS--DKKGQLCIKYIIRHTRRPELGDKFSSRHGQKGVCGIIIQQEDFPFS 938

  Fly   897 ESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPF-RFSEENTAIDYFGKMLEAG 960
            |.|:.||::.||||||||||:..|||.:..|.....|..:..:.| ..|.....::.....|...
plant   939 ELGICPDLIMNPHGFPSRMTVGKMIELLGSKAGVSCGRFHYGSAFGERSGHADKVETISATLVEK 1003

  Fly   961 GYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGG 1025
            |::|.|.:.||||:.|..:.|.||.|.::||:|:|||.||...|.:|.....|.||.:|:.:.||
plant  1004 GFSYSGKDLLYSGISGEPVEAYIFMGPIYYQKLKHMVLDKMHARGSGPRVMMTRQPTEGKSKNGG 1068

  Fly  1026 VRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTC 1090
            :|.||||||.||::||:.|:.:||..:||.....||..|| :|......:|:          ..|
plant  1069 LRVGEMERDCLIAYGASMLIYERLMISSDPFEVQVCRACG-LLGYYNYKLKK----------AVC 1122

  Fly  1091 RLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLNE 1128
            ..|.:..:::.:::|::.|.|..||.|:|:..|.||.|
plant  1123 TTCKNGDNIATMKLPYACKLLFQELQSMNVVPRLKLTE 1160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 319/1187 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 317/1183 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 12/51 (24%)
NRPC2NP_001332060.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.