DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and NRPB2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_193902.1 Gene:NRPB2 AraportID:AT4G21710 Length:1188 Species:Arabidopsis thaliana

Alignment Length:1213 Identity:345/1214 (28%)
Similarity:552/1214 (45%) Gaps:210/1214 (17%)


  Fly    40 VDSFDEMLTVGL----DNSAKHMI-------PNHWLSPAGEKISMKVESIWIAKPKVPQDVIDVR 93
            :|||||.:...:    |.||...|       |.|....|.....:....|:::||.:.:.  |..
plant    44 LDSFDEFIQNTMQEIVDESADIEIRPESQHNPGHQSDFAETIYKISFGQIYLSKPMMTES--DGE 106

  Fly    94 TREIYPTDSRQLHVSYSGMCSV-------RLGWSVNGVQKTP--INMDLGEVPIMLRSKACNLGQ 149
            |..::|..:|..:::||....|       :.|.....|.:|.  ..:.:|:|||||||..|.|.|
plant   107 TATLFPKAARLRNLTYSAPLYVDVTKRVIKKGHDGEEVTETQDFTKVFIGKVPIMLRSSYCTLFQ 171

  Fly   150 ATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTV 214
            .:.:::.:.||...:.||.|:|.|:||::........||....|    |.:...::.:|. |:::
plant   172 NSEKDLTELGECPYDQGGYFIINGSEKVLIAQEKMSTNHVYVFK----KRQPNKYAYVGE-VRSM 231

  Fly   215 REDESSLSNV--VHYLNNGTAKFMFS--HVK-RLSY----VPVCLILKCLMDYTDEEIYNRLVQG 270
            .|:::...:.  |..|...:||...|  ::: .|.|    :|:.::.:.|....|::|...:...
plant   232 AENQNRPPSTMFVRMLARASAKGGSSGQYIRCTLPYIRTEIPIIIVFRALGFVADKDILEHICYD 296

  Fly   271 YESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERV 332
            : :|...:..::..|.|   :||:.|     ...:||.  |.....|.:.:......| ||::.:
plant   297 F-ADTQMMELLRPSLEEAFVIQNQLV-----ALDYIGK--RGATVGVTKEKRIKYARD-ILQKEM 352

  Fly   333 MIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPG--------HLYQKYL 385
            :.|:...|    .|.....::|.:|..||.|:...::.|....:.:.|.|        .|::| |
plant   353 LPHVGIGEHCETKKAYYFGYIIHRLLLCALGRRPEDDRDHYGNKRLDLAGPLLGGLFRMLFRK-L 416

  Fly   386 SERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQN 450
            :..|.|:   |::|:..         ...|..|...:|..:...::..|||||.......|....
plant   417 TRDVRSY---VQKCVDN---------GKEVNLQFAIKAKTITSGLKYSLATGNWGQANAAGTRAG 469

  Fly   451 SGLVIMAENINRMRY---MSHFRAIH-----RGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTP 507
                 :::.:||:.|   :||.|.::     .|      :..:.|||....||.:||..||:|..
plant   470 -----VSQVLNRLTYASTLSHLRRLNSPIGREG------KLAKPRQLHNSQWGMMCPAETPEGQA 523

  Fly   508 CGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMG----------MMPLSNRRYLGEKLYVVFLDGK 562
            |||:.:|.|...|::   ......|.:.|.:.|          ::|.:.:         :|::|.
plant   524 CGLVKNLALMVYITV---GSAAYPILEFLEEWGTENFEEISPSVIPQATK---------IFVNGM 576

  Fly   563 HLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVW---NL 624
            .:| :|: :.:.:|..||  ::...:....|:|.:   ::.:...|.|.|...|..||::   |.
plant   577 WVG-VHR-DPDMLVKTLR--RLRRRVDVNTEVGVV---RDIRLKELRIYTDYGRCSRPLFIVDNQ 634

  Fly   625 K---------------------WKR------VEYIGTLEQ----LYMEIA------IDAKEMYPD 652
            |                     |..      :|||.|.|:    :.|.|:      :..:|.|.:
plant   635 KLLIKKRDIYALQQRESAEEDGWHHLVAKGFIEYIDTEEEETTMISMTISDLVQARLRPEEAYTE 699

  Fly   653 FTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGT 717
            ..||.|:..:..:...|::||.||:||||||.||..||||.||....|:..:.....|.|..|..
plant   700 NYTHCEIHPSLILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQK 764

  Fly   718 PLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGF-------AY------- 768
            ||......:::.......|.|||||:..|:||:.||::|:|:::.:|||       :|       
plant   765 PLVTTRAMEHLHFRQLPAGINAIVAISCYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKM 829

  Fly   769 GSIYKTKFLTLDKKSSYFARHPHMPELIKHLDTDGLPHPGSKLS-----YGSPLYCYFD---GEV 825
            |::.|..|...|:.|:...||....:    ||.|||..||:::|     .|.......|   |:.
plant   830 GTLVKEDFGRPDRGSTMGMRHGSYDK----LDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQS 890

  Fly   826 ATY----KVVKMDEKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQ 886
            :.|    ..:.:...|..:|:.:  |.:.:....:.|.:.:|..|...|||||:||.||||....
plant   891 SRYTRRDHSISLRHSETGMVDQV--LLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGM 953

  Fly   887 KYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAID 951
            .|..||:|:|..|:.|||:.|||..||||||..:||.:.||.||..|...|||||    .:..:|
plant   954 TYTQEDMPWTIEGVTPDIIVNPHAIPSRMTIGQLIECIMGKVAAHMGKEGDATPF----TDVTVD 1014

  Fly   952 YFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQP 1016
            ...|.|...||...|.||:|:|..||.:||.||.|..:||||:|||.||...|..|.|:..|.||
plant  1015 NISKALHKCGYQMRGFERMYNGHTGRPLTAMIFLGPTYYQRLKHMVDDKIHSRGRGPVQILTRQP 1079

  Fly  1017 IKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSI-LAPLQRIVKRNET 1080
            .:||.|.||:||||||||.:|:||||..|::|||..||.....||..||.| :|.|    |:|..
plant  1080 AEGRSRDGGLRFGEMERDCMIAHGAAHFLKERLFDQSDAYRVHVCEVCGLIAIANL----KKNSF 1140

  Fly  1081 GGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
                    .||.|.:.:.:..:.||::.|.|..||.|:.|..|
plant  1141 --------ECRGCKNKTDIVQVYIPYACKLLFQELMSMAIAPR 1175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 345/1214 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 345/1214 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 10/50 (20%)
NRPB2NP_193902.1 PRK08565 27..1179 CDD:236291 345/1214 (28%)
RNA_pol_B_RPB2 39..1176 CDD:238353 345/1214 (28%)
RNA_pol_Rpb2_4 571..632 CDD:282431 15/68 (22%)
RNA_pol_Rpb2_5 657..708 CDD:282432 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.