DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and NRPD2A

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001189957.1 Gene:NRPD2A AraportID:AT3G23780 Length:1172 Species:Arabidopsis thaliana

Alignment Length:1185 Identity:316/1186 (27%)
Similarity:509/1186 (43%) Gaps:189/1186 (16%)


  Fly    42 SFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAKPKVPQDVIDVRTREIYPTDSRQLH 106
            ||.|||.....:..|.. .|.|     ...::|...:.:.||..   ..|.:..|..|..:|..:
plant    70 SFGEMLVEPSFDVVKKK-DNDW-----RYATVKFGEVTVEKPTF---FSDDKELEFLPWHARLQN 125

  Fly   107 VSYSGMCSVRLGWSV----------------NGVQKTPINMD-----LGEVPIMLRSKACNLGQA 150
            ::||....|.:...|                |.|:|..:::.     :|.:|:|::|..|...: 
plant   126 MTYSARIKVNVQVEVFKNTVVKSDKFKTGQDNYVEKKILDVKKQDILIGSIPVMVKSILCKTSE- 189

  Fly   151 TPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQT 213
            ..:|..|.|:...:.||.|||:|.||  |.:..:.|:|   :.:..|.|....::.:.....:..
plant   190 KGKENCKKGDCAFDQGGYFVIKGAEKVFIAQEQMCTKR---LWISNSPWTVSFRSENKRNRFIVR 251

  Fly   214 VREDESSLSN-------VVHYLNNGTAKFMFSHVKRLSYVPVCLILKCL-------------MDY 258
            :.|:|.:...       .|::|:              :.:||.|:...|             .|.
plant   252 LSENEKAEDYKRREKVLTVYFLS--------------TEIPVWLLFFALGVSSDKEAMDLIAFDG 302

  Fly   259 TDEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDV 323
            .|..|.|.|:    :..:....|....|...|...|...|.||       .:||      |.:.|
plant   303 DDASITNSLI----ASIHVADAVCEAFRCGNNALTYVEQQIKS-------TKFP------PAESV 350

  Fly   324 TDFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSER 388
             |..|...:...|.:.:.|.:.:.:|::.|.....||.|.||.||...:.:.|.|.|.::.:...
plant   351 -DECLHLYLFPGLQSLKKKARFLGYMVKCLLNSYAGKRKCENRDSFRNKRIELAGELLEREIRVH 414

  Fly   389 VESWVSQVRRCLQKKLTSPDAL------VTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGL 447
            :.....::.|.:||.|:....|      :.::|:|..:.:|...|.....|.....:        
plant   415 LAHARRKMTRAMQKHLSGDGDLKPIEHYLDASVITNGLSRAFSTGAWSHPFRKMERV-------- 471

  Fly   448 MQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLN 512
               ||:|......|.::.:...|.. |.....|.:..:||...|..||.:|.:.||||..|||:.
plant   472 ---SGVVANLGRANPLQTLIDLRRT-RQQVLYTGKVGDARYPHPSHWGRVCFLSTPDGENCGLVK 532

  Fly   513 HLTLTCEISMRPDPKLVKAI----PKHLIDMGMMPLSNRRYLGEKLYVVFLDGKHLGHIHQSEAE 573
            :::|...:|.:....:|:.:    .:.|:|....||..:       :.|.|:|..:|..  :::|
plant   533 NMSLLGLVSTQSLESVVEKLFACGMEELMDDTCTPLFGK-------HKVLLNGDWVGLC--ADSE 588

  Fly   574 KIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRP---VWNL-KWKR------ 628
            ..|.||:..:....||:.|||     |::.....:.|.|...|::||   |.|| |.|:      
plant   589 SFVAELKSRRRQSELPREMEI-----KRDKDDNEVRIFTDAGRLLRPLLVVENLQKLKQEKPSQY 648

  Fly   629 ----------VEYIGTLEQLYMEIAIDAKEMY--PDFTTHLELAKTHFMSNLANLIPMPDYNQSP 681
                      :|.||..|:.....|...|::.  |...||.||..:..:.....::|..:::...
plant   649 PFDHLLDHGILELIGIEEEEDCNTAWGIKQLLKEPKIYTHCELDLSFLLGVSCAVVPFANHDHGR 713

  Fly   682 RNMYQCQMG-KQTMGTPCLNWPKQAANKL-YRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVI 744
            |.:||.|.. :|.:|....| |....:.| .:|..|..|||:.:..:.::.:....|.||||||.
plant   714 RVLYQSQKHCQQAIGFSSTN-PNIRCDTLSQQLFYPQKPLFKTLASECLKKEVLFNGQNAIVAVN 777

  Fly   745 SYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYFARHPHMPELIK------------ 797
            .:.||:.||::::|||:.|||.......::....:|.|.|  .:...|.||::            
plant   778 VHLGYNQEDSIVMNKASLERGMFRSEQIRSYKAEVDAKDS--EKRKKMDELVQFGKTHSKIGKVD 840

  Fly   798 HLDTDGLPHPGSKLSYGSPLY--CYFDGEVATYKVVKMDEKEDCIVESIRQLGSFDLSPKKMVAI 860
            .|:.||.|..|:.:|.|..:.  |...|  |.:. :|:...|..||:.: .|.|.| ..|...|:
plant   841 SLEDDGFPFIGANMSTGDIVIGRCTESG--ADHS-IKLKHTERGIVQKV-VLSSND-EGKNFAAV 900

  Fly   861 TLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMA 925
            :||..|...:||||:|..||||:.......::.|||..|::||||.|||.||||.|...::|...
plant   901 SLRQVRSPCLGDKFSSMHGQKGVLGYLEEQQNFPFTIQGIVPDIVINPHAFPSRQTPGQLLEAAL 965

  Fly   926 GKG-----------AAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREM 979
            .||           ||.......||||    ....:....:.|...|::.:|.||:|:|..|..|
plant   966 SKGIACPIQKEGSSAAYTKLTRHATPF----STPGVTEITEQLHRAGFSRWGNERVYNGRSGEMM 1026

  Fly   980 TADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFL 1044
            .:.||.|...||||.||..||.:.|:||.|...|.||:..|||.||::|||||||.||:|||:..
plant  1027 RSMIFMGPTFYQRLVHMSEDKVKFRNTGPVHPLTRQPVADRKRFGGIKFGEMERDCLIAHGASAN 1091

  Fly  1045 LQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFK 1109
            |.:|||..||.:...:|.||.:    ...:::|..:.|...:...||:|..:..|..:.:|:..|
plant  1092 LHERLFTLSDSSQMHICRKCKT----YANVIERTPSSGRKIRGPYCRVCVSSDHVVRVYVPYGAK 1152

  Fly  1110 YLVTELSSVNINARF 1124
            .|..||.|:.|...|
plant  1153 LLCQELFSMGITLNF 1167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 316/1186 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 316/1186 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 13/50 (26%)
NRPD2ANP_001189957.1 PRK08565 41..1163 CDD:236291 314/1180 (27%)
RNA_pol_B_RPB2 48..1168 CDD:238353 316/1186 (27%)
RNA_pol_Rpb2_4 574..635 CDD:282431 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.