DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and NRPD2B

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_188437.2 Gene:NRPD2B AraportID:AT3G18090 Length:1055 Species:Arabidopsis thaliana

Alignment Length:1148 Identity:309/1149 (27%)
Similarity:496/1149 (43%) Gaps:205/1149 (18%)


  Fly    70 KISMKVE---SIWIAKPK--------VPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNG 123
            |::.:||   .|.|...|        |.::::||:.::|.                         
plant    15 KVNAQVEVFKKIVIKHDKFKTGQDEYVEKEILDVKKQDIL------------------------- 54

  Fly   124 VQKTPINMDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRR 186
                     :|.:|:|::|..|...: ..:|..|.|....:.||.|||:|.||  |.:..:.|:|
plant    55 ---------IGSIPVMVKSVLCKTSE-KGKENCKKGNCAFDQGGYFVIKGAEKVFIAQEQMCTKR 109

  Fly   187 NHPICVKRSSWKDRGQNFSDLGMLVQTVREDESS-----LSNV--VHYLNNGTAKFMFSHVKRLS 244
               :.:..|.|....::.:.....:..:.|:|.:     :..|  |::|:              :
plant   110 ---LWISNSPWTVSFRSETKRNRFIVRLSENEKAEDYKIMEKVLTVYFLS--------------T 157

  Fly   245 YVPVCLILKCL-------------MDYTDEEIYNRLVQG-YESDQYYVSCVQAMLREVQNENVYT 295
            .:||.|:...|             .|..|..|.|.|:.. :|:|     .|....|...|...|.
plant   158 EIPVWLLFFALGVSSDKEAMDLIAFDGDDASITNSLIASIHEAD-----AVCEAFRCGNNALTYV 217

  Fly   296 HAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGK 360
            ..|.||       .:||      |.:.|.| .||..:...|...:.|.:.:.:|::.|.....||
plant   218 EHQIKS-------TKFP------PAESVDD-CLRLYLFPCLQGLKKKARFLGYMVKCLLSAYAGK 268

  Fly   361 YKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDAL------VTSAVMTQC 419
            .|.||.||...:.:.|.|.|.::.:...:.....::.|.:||:|:....|      :.::|:|..
plant   269 RKCENRDSFRNKRIELAGELLEREIRVHLAHARRKMTRAMQKQLSGDGDLKPIEHYLDASVITNG 333

  Fly   420 MRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTT 484
            :.:|...|.....|.....:           ||:|......|.::.:...|.. |.....|.:..
plant   334 LNRAFSTGAWSHPFRKMERV-----------SGVVANLGRANPLQTLIDLRRT-RQQVLYTGKVG 386

  Fly   485 EARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMGMMPLSN--- 546
            :||...|..||.:|.:.||||..|||:.:::|...:|.:.    ::::.:.|...||..|.|   
plant   387 DARHPHPSHWGRVCFLSTPDGENCGLVKNMSLLGLVSTQG----LESVVEMLFTCGMEELMNDTS 447

  Fly   547 RRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIA 611
            ....|:  :.|.|:|..:|..  :::|..|.||:..:....||..|||     |::.....:.|.
plant   448 TPLCGK--HKVLLNGDWVGLC--ADSESFVGELKSRRRQSELPLEMEI-----KRDKDDNEVRIF 503

  Fly   612 TGPARMMRP---VWNL-KWKR----------------VEYIGTLEQLYMEIAIDAKEMY--PDFT 654
            |...|::||   |.|| |.|:                :|.||..|:.....|...|::.  |...
plant   504 TDAGRLLRPLLVVENLHKLKQDKPTQYPFKHLLDQGILELIGIEEEEDCTTAWGIKQLLKEPKNY 568

  Fly   655 THLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMG-KQTMGTPCLNWPKQAANKL-YRLQTPGT 717
            ||.||..:..:.....::|..:::...|.:||.|.. :|.:|....| |....:.| .:|..|..
plant   569 THCELDLSFLLGVSCAIVPFANHDHGKRVLYQSQKHCQQAIGFSSTN-PNIRCDTLSQQLFYPQK 632

  Fly   718 PLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKK 782
            |||:.:..:.::.:....|.||||||..:.||:.||::::|||:.|||.......::....:|.|
plant   633 PLFKTLASECLEKEVLFNGQNAIVAVNVHLGYNQEDSIVMNKASLERGMFRSEQIRSYKAEVDTK 697

  Fly   783 SSYFARHPHMPELIK------------HLDTDGLPHPGSKLSYGSPLY--CYFDGEVATYKVVKM 833
            .|  .:...|.||::            .|:.||.|..|:.:|.|..:.  |...|  |.:. :|:
plant   698 DS--EKRKKMDELVQFGKTYSKIGKVDSLEDDGFPFIGANMSTGDIVIGRCTESG--ADHS-IKL 757

  Fly   834 DEKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTES 898
            ...|..||:.: .|.|.| ..|...|::||..|...:||||:|..||||:.......::.|||..
plant   758 KHTERGIVQKV-VLSSND-EGKNFAAVSLRQVRSPCLGDKFSSMHGQKGVLGYLEEQQNFPFTIQ 820

  Fly   899 GLIPDIVFNPHGFPSRMTIAMMIETMAGKG------------AAIHGNVYDATPFRFSEENTAID 951
            |::||||.|||.||||.|...::|....||            ||.......||||    ....:.
plant   821 GIVPDIVINPHAFPSRQTPGQLLEAALSKGIACPIQKKEGSSAAYTKLTRHATPF----STPGVT 881

  Fly   952 YFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQP 1016
            ...:.|...|::.:|.||:|:|..|..|.:.||.|...||||.||..:|.:.|:||.|...|.||
plant   882 EITEQLHRAGFSRWGNERVYNGRSGEMMRSLIFMGPTFYQRLVHMSENKVKFRNTGPVHPLTRQP 946

  Fly  1017 IKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETG 1081
            :..|||.||:||||||||.||:|||:..|.:|||..||.:...:|.||.:    ...:::|..:.
plant   947 VADRKRFGGIRFGEMERDCLIAHGASANLHERLFTLSDSSQMHICRKCKT----YANVIERTPSS 1007

  Fly  1082 GLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARF 1124
            |...:...||:|..:..|..:.:|:..|.|..||.|:.|...|
plant  1008 GRKIRGPYCRVCASSDHVVRVYVPYGAKLLCQELFSMGITLNF 1050

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 309/1149 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 309/1149 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 13/50 (26%)
NRPD2BNP_188437.2 PRK08565 1..1046 CDD:236291 307/1143 (27%)
RNA_pol_B_RPB2 3..1051 CDD:238353 309/1149 (27%)
RNA_pol_Rpb2_4 456..517 CDD:282431 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.