DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and Polr3b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_081699.1 Gene:Polr3b MGIID:1917678 Length:1133 Species:Mus musculus

Alignment Length:1208 Identity:349/1209 (29%)
Similarity:551/1209 (46%) Gaps:187/1209 (15%)


  Fly    10 TIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMK 74
            |.|:.| ...:::.:|..|.  :..|...|:|||:..:.|.:....|          |.||::..
Mouse    17 TAPIPT-VEEKWRLLPAFLK--VKGLVKQHIDSFNYFINVEIKKIMK----------ANEKVTSD 68

  Fly    75 VESIWIAK--------PKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPIN- 130
            .:.:|..|        |.| ::..:| ||.:.|.:.|...::||...:|.:.:: .|.|:...| 
Mouse    69 ADPMWYLKYLNIYVGLPDV-EESFNV-TRPVSPHECRLRDMTYSAPITVDIEYT-RGSQRIIRNA 130

  Fly   131 MDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRS 195
            :.:|.:||||||..|.|...||.|..|..|...:.||.|:::|.||::.:.....:|..|.    
Mouse   131 LPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIV---- 191

  Fly   196 SWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTD 260
                .......:|..|.:...::.|.:|:.  :..|  :|...|......:|:.:|.|.:...:|
Mouse   192 ----EADRKGAVGASVTSSTHEKKSRTNMA--VKQG--RFYLRHNTLSEDIPIVIIFKAMGVESD 248

  Fly   261 EEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFR-----------ARFPEV 314
            :||    ||...::::.::.....|.|.|...::|..|...:|||..|           .:..|.
Mouse   249 QEI----VQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEA 309

  Fly   315 PEWQPDDDVTDFILRERVMIHLDTYEDKFQ----LIVFMIQKLFQCAQGKYKVENVDSAMMQEVL 375
            .|          :|...::.|:...|..|:    ....|::::. .|||..||::.|....:.:.
Mouse   310 RE----------LLASTILTHVPVKEFNFRAKCIYTAVMVRRVI-LAQGDNKVDDRDYYGNKRLE 363

  Fly   376 LPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQ---AGGVGRAIESFLATG 437
            |.|.|......:..:.:.|::::...:.:  |........:.:.|||   ..|:..||    :||
Mouse   364 LAGQLLSLLFEDLFKKFNSEMKKIADQVI--PKQRAAQFDVVKHMRQDQITNGMVNAI----STG 422

  Fly   438 NIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHR--GSYFTTMRTTEARQLLPDAWGFICPV 500
            |.:.:.  ..|...|   :.:.::|:.|:|....:.|  ..:..|.:.:..|.|.|..||.:||.
Mouse   423 NWSLKR--FKMDRQG---VTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPS 482

  Fly   501 HTPDGTPCGLLNHLTLTCEIS--MRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKL-----YVVF 558
            .||:|..|||:.:|.|...|:  |...|.:..|....:.|:.::       .||:|     ::||
Mouse   483 DTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLL-------CGEELSYPNVFLVF 540

  Fly   559 LDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWN 623
            |:|..||.|.  :.:|:|...|..:..|.:.:     |:....|.....:||::...|:.||...
Mouse   541 LNGNILGVIR--DHKKLVSTFRLMRRAGYINE-----FVSISTNLTDRCVYISSDGGRLCRPYII 598

  Fly   624 LKWKR--------------------------VEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKT 662
            :|.::                          |||:...|:....||:....:..| |||||:...
Mouse   599 VKKQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKD-TTHLEIEPF 662

  Fly   663 HFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDN 727
            ..:...|.|||.|.:||||||.|||.||||.|||...|...:....:|.|..|..|:.:....:.
Mouse   663 TLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIEL 727

  Fly   728 IQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSY------- 785
            |..:....|.||.|||:||:|||:|||:::|||:.:|||....:||....||.:.::.       
Mouse   728 IDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTFDKVMG 792

  Fly   786 -----FARHPHMPELIKH--LDTDGLPHPGSKL---------SYGSPLYCYFDG----EVATYKV 830
                 ..|.|    :.:|  ||.||:..||.|:         |..:......:|    :...||.
Mouse   793 PMLDAATRKP----IWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKD 853

  Fly   831 VKMDEK--EDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDL 893
            |.:..|  .|..:|.:  :.|.:.....::.:.||..|...|||||:||.||||:|....|.||:
Mouse   854 VPITYKGATDSYIEKV--MISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDM 916

  Fly   894 PFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLE 958
            ||.:||:.|||:.||||||||||:..:||.:|||...:.|..:..|.|..|:.....:    .|.
Mouse   917 PFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCE----DLV 977

  Fly   959 AGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRG 1023
            ..||||.|.:.:.||:.|..:.|.|:||.|:||:|:|||.||...|:.|.....|.||.:||.|.
Mouse   978 RHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRD 1042

  Fly  1024 GGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPD 1088
            ||:|.||||||.||.:||:.||.:||..:||.....||.:||.:              |.|.   
Mouse  1043 GGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLL--------------GYSG--- 1090

  Fly  1089 TCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKL 1126
            .|..|..:..||.:.||::.|.|..||.|:||..|.||
Mouse  1091 WCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKL 1128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 344/1185 (29%)
RNA_pol_B_RPB2 35..1125 CDD:238353 342/1181 (29%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/50 (22%)
Polr3bNP_081699.1 PRK08565 26..1129 CDD:236291 346/1199 (29%)
RNA_pol_B_RPB2 39..1127 CDD:238353 342/1181 (29%)
RNA_pol_Rpb2_4 539..600 CDD:282431 18/68 (26%)
RNA_pol_Rpb2_5 621..661 CDD:282432 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.