DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr3b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:XP_021323450.1 Gene:polr3b ZFINID:ZDB-GENE-030131-2887 Length:1130 Species:Danio rerio

Alignment Length:1230 Identity:359/1231 (29%)
Similarity:557/1231 (45%) Gaps:209/1231 (17%)


  Fly     1 MLEE-----MQQMKTIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIP 60
            ||:|     ..|....||.| ...::|.:|..|.  :..|...|:|||:..:.|.:....|    
Zfish     1 MLQEEFGEMSPQQLAAPVDT-VEEKWKLLPAFLK--VKGLVKQHIDSFNYFINVEIKKIMK---- 58

  Fly    61 NHWLSPAGEKISMKVESIWIAK--------PKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRL 117
                  |.|||:...:.:|..|        |.| ::..:| ||.:.|.:.|...::||...:|.:
Zfish    59 ------ANEKITSDADPMWYLKYLNIYVGMPDV-EESFNV-TRPVSPHECRLRDMTYSAPITVDI 115

  Fly   118 GWSVNGVQKTPIN-MDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRML 181
            .:: .|.|:...| :.:|.:||||||..|.|...||.|..|..|...:.||.|:::|.||::.:.
Zfish   116 EYT-RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQ 179

  Fly   182 IMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYV 246
            ....:|..|.       |:.:. ..:|..|.:...::.|.:|::  :..|  :|...|.......
Zfish   180 EQLSKNRIIV-------DQDRK-GTVGASVTSSTHEKKSRTNMI--VKQG--RFYLKHNTLSEDA 232

  Fly   247 PVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGN-LFRAR 310
            |:.:|.|.:...:|:||    ||...::::.::.....|.|.|...::|..|...:||| :.|.|
Zfish   233 PIAIIFKAMGVESDQEI----VQMIGTEEHVMAAFAPSLEECQKAQIFTQTQALRYIGNKVRRQR 293

  Fly   311 FPEVPEWQPDDDVTDFILRERVMIHLDTYEDKFQ----LIVFMIQKLFQCAQGKYKVENVDSAMM 371
            ....|:....::..: :|...::.|:...|..|:    .:..|::::. .|||..||::.|....
Zfish   294 MWGGPKKTKMEEARE-LLASTILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGDNKVDDRDYYGN 356

  Fly   372 QEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQ---AGGVGRAIESF 433
            :.:.|.|.|......:..:.:.|::::...:.:  |........:.:.|||   ..|:..||   
Zfish   357 KRLELAGQLLSLLFEDLFKKFNSELKKIADQII--PKQRAAQFDVVKHMRQDQITNGMVNAI--- 416

  Fly   434 LATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHR--GSYFTTMRTTEARQLLPDAWGF 496
             :|||.:.:.  ..|...|   :.:.::|:.::|....:.|  ..:..|.:.:..|.|.|..||.
Zfish   417 -STGNWSLKR--FKMDRQG---VTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSLQPSQWGM 475

  Fly   497 ICPVHTPDGTPCGLLNHLTLTCEIS--MRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKL----- 554
            :||..||:|..|||:.:|.|...|:  |...|.:..|....:.|:.::       .||:|     
Zfish   476 LCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLL-------CGEELSYPTV 533

  Fly   555 YVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMR 619
            ::|||:|..||.|.  :.:|:|...|..:..|.:.:     |:....|.....:||::...|:.|
Zfish   534 FLVFLNGNILGVIR--DHQKLVYTFRLMRRAGFINE-----FVSISTNLTDRCVYISSDGGRLCR 591

  Fly   620 P----------VWN----------------LKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLE 658
            |          |.|                |....|||:...|:....||: .:.|....|||||
Zfish   592 PYIIVKNGKPAVKNKHIEELSQGYRTFEDFLHESLVEYLDVNEENDCNIAL-YEHMISKDTTHLE 655

  Fly   659 LAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPV 723
            :.....:...|.|||.|.:||||||.|||.||||.|||...|...:....:|.|..|..|:.:..
Zfish   656 IEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTK 720

  Fly   724 HYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYF-- 786
            ..:.|..:....|.||.|||:||:|||:|||:::|||:.:|||....:||....||.:.::..  
Zfish   721 TIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTFD 785

  Fly   787 ----------ARHPHMPELIKH--LDTDGLPHPGSKLSY-----------------------GSP 816
                      .|.|    :.:|  ||.||:..||.|:..                       |.|
Zfish   786 KVMGPMLDAETRKP----IWRHSILDADGICSPGEKVENKQVLVNKSMPTVTQTPLEGSAQPGQP 846

  Fly   817 LY----CYFDGEVATY--KVVKMDEKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFA 875
            .|    ..:.|...:|  ||:.....||..                :|.|.||..|...|||||:
Zfish   847 QYREVPVSYKGATDSYIEKVMISSNAEDAF----------------LVKILLRQTRRPEIGDKFS 895

  Fly   876 SRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATP 940
            ||.||||:|....|.||:||.:||:.|||:.||||:|||||:..:||.:|||...:.|..:..|.
Zfish   896 SRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTA 960

  Fly   941 FRFSEENTA----IDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKW 1001
            |..|:....    |.|        ||||.|.:.:.||:.|..:.|.|:||.|:||:|:|||.||.
Zfish   961 FGGSKVKDVCEDLIRY--------GYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM 1017

  Fly  1002 QVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGS 1066
            ..|:.|.....|.||.:||.|.||:|.||||||.||.:||:.||.:||..:||.....||.:||.
Zfish  1018 HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGL 1082

  Fly  1067 ILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKL 1126
            :              |.|.   .|..|..:..||.:.||::.|.|..||.|:||..|.||
Zfish  1083 L--------------GYSG---WCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKL 1125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 349/1193 (29%)
RNA_pol_B_RPB2 35..1125 CDD:238353 347/1189 (29%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/50 (22%)
polr3bXP_021323450.1 RNA_pol_B_RPB2 37..1124 CDD:238353 347/1189 (29%)
RNA_pol_Rpb2_4 536..597 CDD:309626 18/68 (26%)
RNA_pol_Rpb2_5 618..658 CDD:309627 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.