DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and POLR3B

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_060552.4 Gene:POLR3B HGNCID:30348 Length:1133 Species:Homo sapiens

Alignment Length:1181 Identity:343/1182 (29%)
Similarity:543/1182 (46%) Gaps:184/1182 (16%)


  Fly    39 HVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAK--------PKVPQDVIDVRTR 95
            |:|||:..:.|.:....|          |.||::...:.:|..|        |.| ::..:| ||
Human    43 HIDSFNYFINVEIKKIMK----------ANEKVTSDADPMWYLKYLNIYVGLPDV-EESFNV-TR 95

  Fly    96 EIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPIN-MDLGEVPIMLRSKACNLGQATPEEMVKHG 159
            .:.|.:.|...::||...:|.:.:: .|.|:...| :.:|.:||||||..|.|...||.|..|..
Human    96 PVSPHECRLRDMTYSAPITVDIEYT-RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLN 159

  Fly   160 EHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNV 224
            |...:.||.|:::|.||::.:.....:|..|.        .......:|..|.:...::.|.:|:
Human   160 ECPLDPGGYFIVKGVEKVILIQEQLSKNRIIV--------EADRKGAVGASVTSSTHEKKSRTNM 216

  Fly   225 VHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQ 289
            .  :..|  :|...|......:|:.:|.|.:...:|:||    ||...::::.::.....|.|.|
Human   217 A--VKQG--RFYLRHNTLSEDIPIVIIFKAMGVESDQEI----VQMIGTEEHVMAAFGPSLEECQ 273

  Fly   290 NENVYTHAQCKSFIGNLFR-----------ARFPEVPEWQPDDDVTDFILRERVMIHLDTYEDKF 343
            ...::|..|...:|||..|           .:..|..|          :|...::.|:...|..|
Human   274 KAQIFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARE----------LLASTILTHVPVKEFNF 328

  Fly   344 Q----LIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKL 404
            :    ....|::::. .|||..||::.|....:.:.|.|.|......:..:.:.|::::...:.:
Human   329 RAKCIYTAVMVRRVI-LAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVI 392

  Fly   405 TSPDALVTSAVMTQCMRQ---AGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYM 466
              |........:.:.|||   ..|:..||    :|||.:.:.  ..|...|   :.:.::|:.|:
Human   393 --PKQRAAQFDVVKHMRQDQITNGMVNAI----STGNWSLKR--FKMDRQG---VTQVLSRLSYI 446

  Fly   467 SHFRAIHR--GSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEIS--MRPDPK 527
            |....:.|  ..:..|.:.:..|.|.|..||.:||..||:|..|||:.:|.|...|:  |...|.
Human   447 SALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPI 511

  Fly   528 LVKAIPKHLIDMGMMPLSNRRYLGEKL-----YVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGT 587
            :..|....:.|:.::       .||:|     ::|||:|..||.|.  :.:|:|:..|..:..|.
Human   512 VKLASNLGVEDVNLL-------CGEELSYPNVFLVFLNGNILGVIR--DHKKLVNTFRLMRRAGY 567

  Fly   588 LPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLKWKR------------------------ 628
            :.:     |:....|.....:||::...|:.||...:|.::                        
Human   568 INE-----FVSISTNLTDRCVYISSDGGRLCRPYIIVKKQKPAVTNKHMEELAQGYRNFEDFLHE 627

  Fly   629 --VEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGK 691
              |||:...|:....||:....:..| |||||:.....:...|.|||.|.:||||||.|||.|||
Human   628 SLVEYLDVNEENDCNIALYEHTINKD-TTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGK 691

  Fly   692 QTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMI 756
            |.|||...|...:....:|.|..|..|:.:....:.|:.:....|.||.|||:||:|||:|||::
Human   692 QAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALV 756

  Fly   757 INKAAYERGFAYGSIYKTKFLTLDKKSSY------------FARHPHMPELIKH--LDTDGLPHP 807
            :|||:.:|||....:||....||.:.::.            ..|.|    :.:|  ||.||:..|
Human   757 LNKASLDRGFGRCLVYKNAKCTLKRYTNQTFDKVMGPMLDAATRKP----IWRHEILDADGICSP 817

  Fly   808 GSKL---------SYGSPLYCYFDG----EVATYKVVKMDEK--EDCIVESIRQLGSFDLSPKKM 857
            |.|:         |..:......:|    :...||.|.:..|  .|..:|.:  :.|.:.....:
Human   818 GEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSYIEKV--MISSNAEDAFL 880

  Fly   858 VAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIE 922
            :.:.||..|...|||||:||.||||:|....|.||:||.:||:.|||:.||||||||||:..:||
Human   881 IKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIE 945

  Fly   923 TMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGV 987
            .:|||...:.|..:..|.|..|:.....:    .|...||||.|.:.:.||:.|..:.|.|:||.
Human   946 LLAGKAGVLDGRFHYGTAFGGSKVKDVCE----DLVRHGYNYLGKDYVTSGITGEPLEAYIYFGP 1006

  Fly   988 VHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHN 1052
            |:||:|:|||.||...|:.|.....|.||.:||.|.||:|.||||||.||.:||:.||.:||..:
Human  1007 VYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMIS 1071

  Fly  1053 SDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSS 1117
            ||.....||.:||.:              |.|.   .|..|..:..||.:.||::.|.|..||.|
Human  1072 SDAFEVDVCGQCGLL--------------GYSG---WCHYCKSSCHVSSLRIPYACKLLFQELQS 1119

  Fly  1118 VNINARFKLNE 1128
            :||..|.||::
Human  1120 MNIIPRLKLSK 1130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 343/1180 (29%)
RNA_pol_B_RPB2 35..1125 CDD:238353 341/1177 (29%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/50 (22%)
POLR3BNP_060552.4 RNA_pol_B_RPB2 39..1127 CDD:238353 341/1177 (29%)
RNA_pol_Rpb2_4 539..600 CDD:309626 18/68 (26%)
RNA_pol_Rpb2_5 621..661 CDD:309627 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.