DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and POLR2B

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_000929.1 Gene:POLR2B HGNCID:9188 Length:1174 Species:Homo sapiens

Alignment Length:1234 Identity:341/1235 (28%)
Similarity:546/1235 (44%) Gaps:257/1235 (21%)


  Fly    40 VDSFDEML------------TVGLDNSAKHMIPNHWLSPAGE-----KISMKVESIWIAKPK--- 84
            :|||||.:            .:.|...|:|        .:||     :..:|.|.|:::||.   
Human    44 LDSFDEFIQMSVQRIVEDAPPIDLQAEAQH--------ASGEVEEPPRYLLKFEQIYLSKPTHWE 100

  Fly    85 ---VPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSV---------NGVQKTPINMDLGEVP 137
               .|..::        |.::|..:::||....|.:..:|         ...|||.|    |::|
Human   101 RDGAPSPMM--------PNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFI----GKIP 153

  Fly   138 IMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRRNHPICVKRSSWKDR 200
            |||||..|.|...|..::.:..|...:.||.|:|.|:||  |.:..:.|...:....|.|.:...
Human   154 IMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYT 218

  Fly   201 GQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSH--VKRLSY----VPVCLILKCLMDYT 259
            |:..|   .|..:.|...:...:::.....|..|.....  |..|.|    ||:.::.:.|...:
Human   219 GECRS---CLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVS 280

  Fly   260 DEEIYNRLVQGYESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDD 321
            |.:|...::..:| |...:..|:..|.|   :|.:||     ..:|||:  |...|.|.: :...
Human   281 DRDILEHIIYDFE-DPEMMEMVKPSLDEAFVIQEQNV-----ALNFIGS--RGAKPGVTK-EKRI 336

  Fly   322 DVTDFILRERVMIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQ 382
            .....:|::.::.|:...:    .|...:.:|:.:|...|.|:.::::.|....:.:.|.|.|..
Human   337 KYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLA 401

  Fly   383 KYLSERVESWVSQVRRCLQKKL-TSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA------ 440
            .......::.:.:||...||.: ...|..:..|:.|:.      :...::..|||||..      
Human   402 FLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRI------ISDGLKYSLATGNWGDQKKAH 460

  Fly   441 -SRTGLGLMQNSGLVIMAENINRMRY---MSHFRAIH----RGSYFTTMRTTEARQLLPDAWGFI 497
             :|.|           :::.:||:.:   :||.|.::    |..     :..:.|||....||.:
Human   461 QARAG-----------VSQVLNRLTFASTLSHLRRLNSPIGRDG-----KLAKPRQLHNTLWGMV 509

  Fly   498 CPVHTPDGTPCGLLNHLTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRY 549
            ||..||:|...||:.:|.|...||:  :|.|           .|.:..|..:.|...        
Human   510 CPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATK-------- 566

  Fly   550 LGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIAT 612
                   :|::|..:| ||: :.|::::.||      .|.:.|:|  ..:...::.:...:.|.|
Human   567 -------IFVNGCWVG-IHK-DPEQLMNTLR------KLRRQMDIIVSEVSMIRDIREREIRIYT 616

  Fly   613 GPARMMRPVW-----------------------NLKWKR------VEYIGTLEQLYMEIA----- 643
            ...|:.||:.                       |..|:.      ||||.|||:..:.:|     
Human   617 DAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDD 681

  Fly   644 IDAKEM-YPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAAN 707
            :..||: |....||.|:..:..:...|::||.||:||||||.||..||||.||....|:..:...
Human   682 LQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDT 746

  Fly   708 KLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIY 772
            ..:.|..|..||......:.::..:...|.|:|||:.|||||:.||::|:|::|.:||| :.|::
Human   747 LAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGF-FRSVF 810

  Fly   773 KTKFLTLDKKSSY---------------FARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFD 822
            ...:...:.|..:               ..||    .:...||.|||..||.::|         .
Human   811 YRSYKEQESKKGFDQEEVFEKPTRETCQGMRH----AIYDKLDDDGLIAPGVRVS---------G 862

  Fly   823 GEVATYKVVKMDEKEDCIVESIRQLGSFDLSP---------------------KKMVAITLRVPR 866
            .:|...|.|.:.|.||.:..:.|:....|.|.                     .|...|.:|..|
Human   863 DDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVR 927

  Fly   867 PATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAI 931
            ...||||||||.||||.|..:|..||:|||..|:.|||:.|||..||||||..:||.:.||.:|.
Human   928 IPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSAN 992

  Fly   932 HGNVYDATPFRFSEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLR 994
            .|.:.|||||     |.|::.  ...:|...||:..|.|.||:|..||::|:.||.|..:||||:
Human   993 KGEIGDATPF-----NDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLK 1052

  Fly   995 HMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTL 1059
            |||.||...|:.|.::....||::||.|.||:||||||||..|:||||..|::|||..||.....
Human  1053 HMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVH 1117

  Fly  1060 VCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            ||:.|| |:|          .....:....||.|.:.:.:|::.:|::.|.|..||.|::|..|
Human  1118 VCNLCG-IMA----------IANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPR 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 341/1235 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 341/1235 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/52 (21%)
POLR2BNP_000929.1 PRK08565 27..1172 CDD:236291 341/1235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.