DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and RpII140

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001287323.1 Gene:RpII140 FlyBaseID:FBgn0262955 Length:1176 Species:Drosophila melanogaster

Alignment Length:1234 Identity:340/1235 (28%)
Similarity:548/1235 (44%) Gaps:256/1235 (21%)


  Fly    40 VDSFDEML------------TVGLDNSAKHMIPNHWLSPAGE-----KISMKVESIWIAKPKVPQ 87
            :|||||.:            .:.|...|:|        .:||     :.|:|.|.|:::||...:
  Fly    45 LDSFDEFIQMSVQRIVEDSPAIELQAEAQH--------TSGEVETPPRFSLKFEQIYLSKPTHWE 101

  Fly    88 DVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMD-----LGEVPIMLRSKACNL 147
            .  |.....:.|.::|..:::||....|.:..:.|.....|:...     :|::||||||..|.|
  Fly   102 K--DGSPSPMMPNEARLRNLTYSAPLYVDITKTKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLL 164

  Fly   148 GQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNF-SDLGMLV 211
            .|.|..::.:..|...:.||.|:|.|:||:   ||...:.....|...|.||....| :::...:
  Fly   165 SQLTDRDLTELNECPLDPGGYFIINGSEKV---LIAQEKMATNTVYVFSMKDGKYAFKTEIRSCL 226

  Fly   212 QTVREDESSLSNVVHYLNNGTAKFMFSHVKR-----LSY----VPVCLILKCLMDYTDEEIYNRL 267
            :......|:|  .|:.:..|:.....|.:.:     |.|    :|:.::.:.|....|.:|...:
  Fly   227 EHSSRPTSTL--WVNMMARGSQNIKKSAIGQRIIAILPYIKQEIPIMIVFRALGFVADRDILEHI 289

  Fly   268 VQGYESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDV--TDFI 327
            :..:: |...:..|:..|.|   ||.:||     ..:|||  .|...|.|.:   |..:  ...|
  Fly   290 IYDFD-DPEMMEMVKPSLDEAFVVQEQNV-----ALNFIG--ARGARPGVTK---DKRIKYAKEI 343

  Fly   328 LRERVMIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSER 388
            |::.::.|:...:    .|...:.:|:.:|...:.|:.::::.|....:.:.|.|.|........
  Fly   344 LQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLASLGRRELDDRDHYGNKRLDLAGPLLAFLFRGL 408

  Fly   389 VESWVSQVRRCLQK-----KLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA-------S 441
            .::.:.:||...||     |..:.:..:.:.::|..:|.:          |||||..       :
  Fly   409 FKNLMKEVRMYTQKFIDRGKDFNLELAIKTNIITDGLRYS----------LATGNWGDQKKAHQA 463

  Fly   442 RTGLGLMQNSGLVIMAENINRMRY---MSHFRAIH----RGSYFTTMRTTEARQLLPDAWGFICP 499
            |.|           :::.:||:.:   :||.|.::    |..     :..:.|||....||.:||
  Fly   464 RAG-----------VSQVLNRLTFASTLSHLRRVNSPIGRDG-----KLAKPRQLHNTLWGMLCP 512

  Fly   500 VHTPDGTPCGLLNHLTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRYLG 551
            ..||:|...||:.:|.|...||:  :|.|           .|.:..|..:.|...          
  Fly   513 AETPEGAAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIADATK---------- 567

  Fly   552 EKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIATGP 614
                 :|::|..:| ||: :.|:::..||      .|.:.|:|  ..:...::.:...:.|.|..
  Fly   568 -----IFVNGCWVG-IHR-DPEQLMATLR------KLRRQMDIIVSEVSMIRDIRDREIRIYTDA 619

  Fly   615 ARMMRPVW-----------------------NLKWK------RVEYIGTLEQLYMEIAI---DAK 647
            .|:.||:.                       |..|:      .||||.|||:..:.||:   |.|
  Fly   620 GRICRPLLIVENGSLLLKKTHVEMLKERDYNNYSWQVLVASGVVEYIDTLEEETVMIAMSPYDLK 684

  Fly   648 E----MYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANK 708
            :    .|....||.|:.....:...|::||.||:||||||.||..||||.||....|:..:....
  Fly   685 QDKDYAYCTTYTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTL 749

  Fly   709 LYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYK 773
            .:.|..|..||......:.::..:...|.|:|||::.||||:.||::|:|.:|.|||| :.|::.
  Fly   750 AHVLYYPMKPLVTTRSMEYLRFRELPAGINSIVAILCYTGYNQEDSVILNASAVERGF-FRSVFY 813

  Fly   774 TKFLTLDKK---------------SSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDG 823
            ..:...:.|               :....|:.|..:    ||.||:..||.::|         ..
  Fly   814 RSYKDSENKRVGDQEENFEKPHRGTCQGMRNAHYDK----LDDDGIIAPGIRVS---------GD 865

  Fly   824 EVATYKVVKMDEKEDCIVESIRQLGSFDLSP---------------------KKMVAITLRVPRP 867
            :|...|.:.:.|.:|.:..:.::....|.|.                     .|...|.:|..|.
  Fly   866 DVVIGKTITLPENDDELDSNTKRFSKRDASTFLRNSETGIVDQVMLTLNSEGYKFCKIRVRSVRI 930

  Fly   868 ATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIH 932
            ..||||||||.||||.|..:|..||:.||..||.|||:.|||..||||||..:||.:.||..:..
  Fly   931 PQIGDKFASRHGQKGTCGIQYRQEDMAFTCEGLAPDIIINPHAIPSRMTIGHLIECLQGKLGSNK 995

  Fly   933 GNVYDATPFRFSEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRH 995
            |.:.|||||     |.|::.  ....|:..||:..|.|.:|:|..||::.|.:|.|..:||||:|
  Fly   996 GEIGDATPF-----NDAVNVQKISTFLQEYGYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKH 1055

  Fly   996 MVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLV 1060
            ||.||...|:.|.|:....||::||.|.||:||||||||..||||||..|::|||..||.....:
  Fly  1056 MVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQISHGAAQFLRERLFEVSDPYRVHI 1120

  Fly  1061 CHKCGSI-LAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            |:.||.| :|.|     ||.|       ..|:.|.:.:.:|.:.:|::.|.|..||.|:||..|
  Fly  1121 CNFCGLIAIANL-----RNNT-------FECKGCKNKTQISQVRLPYAAKLLFQELMSMNIAPR 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 340/1235 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 340/1235 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/52 (21%)
RpII140NP_001287323.1 PRK08565 28..1176 CDD:236291 340/1235 (28%)
RNA_pol_B_RPB2 40..1174 CDD:238353 340/1235 (28%)
RNA_pol_Rpb2_4 568..630 CDD:282431 16/70 (23%)
RNA_pol_Rpb2_5 654..702 CDD:282432 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56259385
eggNOG 1 0.900 E1_COG0085
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20856
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.