DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and RpIII128

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_523706.1 Gene:RpIII128 FlyBaseID:FBgn0004463 Length:1137 Species:Drosophila melanogaster

Alignment Length:1191 Identity:327/1192 (27%)
Similarity:548/1192 (46%) Gaps:167/1192 (14%)


  Fly    10 TIPV--LTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKI- 71
            ::|:  ||.   ::|.:|..|  .:..|...|:|||:..:.|.:....|   .|..::...:.: 
  Fly    25 SVPIKPLTE---KWKLVPAFL--QVKGLVKQHIDSFNHFINVDIKKIVK---ANELVTSGADPLF 81

  Fly    72 SMKVESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTP-INMDLGE 135
            .:|...:.:.||.: .|..:: |:...|.:.|....:||...:|.:.:: .|.|:.. .|:.:|.
  Fly    82 YLKYLDVRVGKPDI-DDGFNI-TKATTPHECRLRDTTYSAPITVDIEYT-RGTQRIKRNNLLIGR 143

  Fly   136 VPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSW-KD 199
            :|:|||...|.|...:..|:.|..|...:.||.||:||.||::           :..::.|| |.
  Fly   144 MPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVI-----------LIQEQLSWNKM 197

  Fly   200 RGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIY 264
            ..::|:.: :..|.........|..:....:|  |:...|......:|:.:|.|.|...:|:||.
  Fly   198 LTEDFNGV-VQCQVTSSTHEKKSRTLVLSKHG--KYYLKHNSMTDDIPIVVIFKALGVVSDQEIQ 259

  Fly   265 NRL-VQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGN-LFRARFPEVPEWQPDDDVTDFI 327
            :.: :.....:::..|.:.|     .|..|:|..:...::|: |...||.......|.::..:.:
  Fly   260 SLIGIDSKSQNRFGASLIDA-----YNLKVFTQQRALEYMGSKLVVKRFQSATTKTPSEEARELL 319

  Fly   328 LRERVMIHLDTYEDKFQL------IVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLS 386
            | ..::.|:..  |.|.|      :..|::::......|...::.|....:.:.|.|.|......
  Fly   320 L-TTILAHVPV--DNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFE 381

  Fly   387 ERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNS 451
            :..:....:::....|.:  |........:.:.|| |..:...:||.:::||...:.  ..|:.:
  Fly   382 DLFKRMNWELKTIADKNI--PKVKAAQFDVVKHMR-AAQITAGLESAISSGNWTIKR--FKMERA 441

  Fly   452 GLVIMAENINRMRYMSHFRAIHR--GSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHL 514
            |   :.:.::|:.|:|....:.|  ..:..|.:.:..|.|.|..||.:||..||:|..|||:.:|
  Fly   442 G---VTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNL 503

  Fly   515 TL----TCEISMRPDPKLVKAIPKHLIDMGMM---PLSNRRYLGEKLYVVFLDGKHLG----HIH 568
            .|    |.|:..|  |.::.|....:.|:..:   |::|     ..:::||::|..||    |.|
  Fly   504 ALMTHITTEVEER--PVMIVAFNAGVEDIREVSGNPINN-----PNVFLVFINGNVLGLTLNHKH 561

  Fly   569 QSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLKWKR----- 628
                  :|..|||.:..|.:...:.:.....::     .:||.|...|:.||...::.:|     
  Fly   562 ------LVRNLRYMRRKGRMGSYVSVHTSYTQR-----CIYIHTDGGRLCRPYVIVENRRPLVKQ 615

  Fly   629 ---------------------VEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLI 672
                                 :||:...|:....||.: ::...|.|||||:.....:...|.|:
  Fly   616 HHLDELNRGIRKFDDFLLDGLIEYLDVNEENDSFIAWN-EDQIEDRTTHLEIEPFTLLGVCAGLV 679

  Fly   673 PMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGT 737
            |.|.:||||||.|||.||||.||....|...:..:.:|.|..|..|:.:....:....|....|.
  Fly   680 PYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQ 744

  Fly   738 NAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSY-FAR--HPHMPEL---- 795
            ||.|||:||:|||:|||:|:|||:.:||:....:||....|:.:.::. |.|  .|....|    
  Fly   745 NATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTFDRIMGPMKDALTNKV 809

  Fly   796 -IKH--LDTDGLPHPGSK--------------LSYGSPLYCYFDGEVA--TYKVVKMDEK--EDC 839
             .||  |||||:..||.:              ::..:||    .|:.|  .|..|.:..|  |..
  Fly   810 IFKHDVLDTDGIVAPGEQVQNKQIMINKEMPAVTSMNPL----QGQSAQVPYTAVPISYKGPEPS 870

  Fly   840 IVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDI 904
            .:|  |.:.|.:.....::.|.||..|...|||||:||.||||:.......||:||.:.|:.||:
  Fly   871 YIE--RVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDM 933

  Fly   905 VFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTER 969
            :.||||||||||:...:|.:.||...:.|..:..|.|..|:    ::.....||..|:||.|.:.
  Fly   934 IMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGSK----VEDIQAELERHGFNYVGKDF 994

  Fly   970 LYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERD 1034
            .|||:.|..:.|.|:.|.|:||:|:|||.||...|:.|.....|.||.:||.|.||:|.||||||
  Fly   995 FYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERD 1059

  Fly  1035 ALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSV 1099
            .|||:||:.|:.:||..:||.....||..||.:                 :....|..|..:::|
  Fly  1060 CLISYGASMLIMERLMISSDAFEVDVCRTCGRM-----------------AYCSWCHFCQSSANV 1107

  Fly  1100 SMIEIPFSFKYLVTELSSVNI 1120
            |.|.:|::.|.|..||:|:|:
  Fly  1108 SKISMPYACKLLFQELTSMNV 1128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 321/1166 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 321/1165 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 12/54 (22%)
RpIII128NP_523706.1 PRK08565 34..1135 CDD:236291 324/1180 (27%)
RNA_pol_B_RPB2 47..1133 CDD:238353 321/1165 (28%)
RNA_pol_Rpb2_2 210..370 CDD:282427 29/170 (17%)
RNA_pol_Rpb2_4 546..607 CDD:282431 18/72 (25%)
RNA_pol_Rpb2_5 628..668 CDD:282432 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56259414
eggNOG 1 0.900 E1_COG0085
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20856
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.