DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr1b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_956812.2 Gene:polr1b ZFINID:ZDB-GENE-040426-1598 Length:1132 Species:Danio rerio

Alignment Length:1159 Identity:519/1160 (45%)
Similarity:723/1160 (62%) Gaps:64/1160 (6%)


  Fly     2 LEEMQQMKTIPVLTNSRPEFKQIPKKLSR-HLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLS 65
            |.:...:||.|.|.:.......:||:..| .:..|...|::|||:.:|.||....:.:.|..:|.
Zfish     3 LSKWCNLKTEPSLKHLTEAGFGVPKEKQRVPVQELVKAHIESFDQAVTDGLCRVVEAIPPMEFLY 67

  Fly    66 PAGEKISMK-VESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPI 129
             .|::||:. ||:| |..|.|.:..|. |...::|.:.|....:|.......:.||||||.|..|
Zfish    68 -KGDRISLSFVEAI-IHTPSVSKGGIS-RDLRVFPAECRGRRCTYRAKLVADVSWSVNGVPKGII 129

  Fly   130 NMDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKR 194
            ...||::|||::||.|||...:|:|:::|.|...|.||.|::.|.||::|:|||.|||:||.|.|
Zfish   130 KQSLGQMPIMVKSKLCNLHGLSPKELLEHHEEAEEMGGYFIVNGIEKVIRLLIMPRRNYPIAVSR 194

  Fly   195 SSWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYT 259
            ..:|.|||.::...:.::.|:|:.::::..:|||:|||....|.:.|.|.::|:...||.|:||:
Zfish   195 PKFKSRGQGYTQYAISMRCVKEEHTAINMNLHYLDNGTVMVNFIYRKELFFLPLGFALKALVDYS 259

  Fly   260 DEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVT 324
            |.:||..|::|.|.:.:|.|||..|||.|.::...|..:..:::|..||.:. .:|||...:...
Zfish   260 DYQIYQELIKGREDNSFYKSCVSEMLRIVMDQGCTTKIKVLNYLGERFRVKL-NLPEWFTHEQCA 323

  Fly   325 DFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERV 389
            .|:|.|.:.|||.|..:||.::..|.:|||..|:.:...||.||.|..|||.||.||..:|.|::
Zfish   324 HFLLDECLCIHLKTDVEKFYMLCLMTRKLFSFAKQECMEENPDSPMFHEVLTPGQLYLMFLKEKM 388

  Fly   390 ESWVSQVRRCLQKK------LTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLM 448
            |.|:..|:..|:||      || ||:      ||:.......:.:|.|..|||||:.|:||||::
Zfish   389 EGWLVSVKLALEKKPQRVGGLT-PDS------MTKLFNMGTDLTKAFEYLLATGNLMSKTGLGML 446

  Fly   449 QNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNH 513
            |||||.::|:.:|.:||:||||.:|||:.|..||||..|:|||::|||:||||||||.||||:||
Zfish   447 QNSGLCVVADKLNFIRYLSHFRCVHRGAAFAKMRTTTVRKLLPESWGFLCPVHTPDGEPCGLMNH 511

  Fly   514 LTLTCEISMRPDPKLVKAIPKHLIDMGMMPL-SNRRYLGEKLYVVFLDGKHLGHIHQSEAEKIVD 577
            :|..|||.....|  ...:|..|..:|:... .|........|.|.|||..:|.:.:..|..:::
Zfish   512 MTAHCEIVAPVYP--TSTLPGLLCSLGVNAADGNPGQAYSDCYPVILDGAMIGWVEKEVAPSVIE 574

  Fly   578 ELRYGKIFG--TLPQMMEIGFIP-FKKNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLY 639
            .||..|:.|  .:|...||..:| ..|...:||||:.|.|.||:|.|.||...:.|.||..||:|
Zfish   575 SLRRFKVLGEKKVPPWTEIVLVPQTGKASLYPGLYLFTTPCRMVRTVRNLSLGKQELIGIFEQVY 639

  Fly   640 MEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQ 704
            :.:.|..||:....|||.||.....:|.:|..||..|:||||||||||||.|||||.|..::..:
Zfish   640 LNVGIFEKEIEDGVTTHQELFPHSMLSVVAEFIPFSDHNQSPRNMYQCQMSKQTMGFPLHSYQYR 704

  Fly   705 AANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYG 769
            :.|||||||||.:||.||..||:..:|::.:|||||||||||||||||||||:||:::|||||:|
Zfish   705 SDNKLYRLQTPQSPLVRPAMYDHYDVDNYPIGTNAIVAVISYTGYDMEDAMIVNKSSWERGFAHG 769

  Fly   770 SIYKTKFLTLDKK-----SSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYK 829
            |:|||:.:.|.:|     |..|...|..|:::..||.||||..||.|.||.|.|.|.........
Zfish   770 SVYKTEIIDLSEKVKGDDSIVFGVKPGDPKVMGKLDADGLPFIGSVLKYGDPFYGYISLNTGQSH 834

  Fly   830 VVKMDEKEDCIVESIR------QLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKY 888
            |.....:|.|:|::|:      ..|.|     |.:.:|.||||..|||||||||.|||||.|:.:
Zfish   835 VYFYKYQESCVVDNIKVCSNETGTGRF-----KRICVTSRVPRNPTIGDKFASRHGQKGILSRLW 894

  Fly   889 PAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYF 953
            ||||:||||||:.|||:||||||||||||.|:||:||||.|::||..:|||||.|||||:|:::|
Zfish   895 PAEDMPFTESGMSPDILFNPHGFPSRMTIGMLIESMAGKSASLHGLCHDATPFTFSEENSALEHF 959

  Fly   954 GKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIK 1018
            |::|:|.|||||||||||||:.|.|:.||||.|||:||||||||.||:|||:|||.:..|:||:.
Zfish   960 GELLKAAGYNYYGTERLYSGLSGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPMG 1024

  Fly  1019 GRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGL 1083
            ||...||:||||||||||::||.:|||.||||:.||::...||..|||:|:.|           |
Zfish  1025 GRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAQVCMDCGSLLSTL-----------L 1078

  Fly  1084 SSQPDT----------CRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLN 1127
            ...|..          |.||..:.|:..:.:|:.|||.|.||:::||  :.||:
Zfish  1079 EKPPPNWSATRHRKTICLLCNKSDSIETVSVPYVFKYFVAELAAMNI--KIKLD 1130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 511/1127 (45%)
RNA_pol_B_RPB2 35..1125 CDD:238353 509/1122 (45%)
RNA_pol_Rpa2_4 564..614 CDD:284335 16/53 (30%)
polr1bNP_956812.2 RpoB 16..1132 CDD:223163 514/1147 (45%)
RNA_pol_B_RPB2 37..1130 CDD:238353 511/1124 (45%)
RNA_pol_Rpa2_4 561..614 CDD:284335 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56223480
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7133
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.