DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and rpa2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_595819.2 Gene:rpa2 PomBaseID:SPBP23A10.07 Length:1174 Species:Schizosaccharomyces pombe

Alignment Length:1186 Identity:494/1187 (42%)
Similarity:703/1187 (59%) Gaps:91/1187 (8%)


  Fly     2 LEEMQQMKTIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSP 66
            ||..:..|..|....|.|:.::..|           ||||||:.:...||.|.|...|.......
pombe     6 LERERTFKNPPKDGTSFPDLQKAVK-----------PHVDSFNALTNAGLLNYAVKEIGEKCAFD 59

  Fly    67 A-----------GEKISMKVESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWS 120
            :           |.|||.:|:.:.||||.:.........|::||.::|:...:|.....::..||
pombe    60 SITQEEGGALKFGNKISFRVDEVQIAKPMLSSRERSSINRKVYPAEARERLTTYKSRLVLKFSWS 124

  Fly   121 VNGVQKTPINMDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTR 185
            |||..:.....::|.:|||:||..|:|...:|.|::.|.|...|.||.|::.|.||::||||:.:
pombe   125 VNGGPRQSEMREVGMIPIMVRSNRCHLEGLSPAELIAHKEESEEMGGYFIVNGIEKLIRMLILPK 189

  Fly   186 RNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCL 250
            ||||..:.|.|:.:||.::|..|:.::.||.|:|||:|.:||||||...|.|...|....:|..:
pombe   190 RNHPTAIIRPSFANRGTSYSQYGLSIRCVRPDQSSLTNTLHYLNNGVTMFRFHWRKNEYLIPSMM 254

  Fly   251 ILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVP 315
            |||.|::.:|:||:..:|.....:.:....|:.|||..::..:|:..:...::|:.||... .|.
pombe   255 ILKALLETSDKEIFEGIVGKDLGNTFLTDRVELMLRAYKSYGLYSQTETLQYLGSKFRVVL-GVA 318

  Fly   316 EWQPDDDVTDFILRERVMIHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHL 380
            |...|.:|..|:|::.|::||...:|||:|::|||:||:....|:...:|.||...||:||.|.|
pombe   319 EDLTDVEVGRFLLQKVVLVHLREAKDKFRLLLFMIRKLYALVAGECCADNPDSPQHQEILLGGFL 383

  Fly   381 YQKYLSERVESWVSQVRR--CLQKKLTSP-----DALVTSAVMTQCMRQAGGVGRAIESFLATGN 438
            |.:.|.|::|.|::.:|.  .|..:.::|     |....:.|.::....   :|..::.||:|||
pombe   384 YGQILKEKIEDWLNSIRAQINLDVRRSAPGVDFSDRKYLTRVFSKINND---IGTKLQYFLSTGN 445

  Fly   439 IASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTP 503
            :.|.|||.|.|.:|..::||.:|..|::||||.:|||::|..::||..|:|||:||||:||||||
pombe   446 LVSNTGLDLQQATGYTVVAEKLNFYRFLSHFRMVHRGAFFAELKTTTVRKLLPEAWGFMCPVHTP 510

  Fly   504 DGTPCGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEK--LYVVFLDGKHLGH 566
            ||:||||||||...|||...|..  |..||..|:.:|:.|.|   .:|.:  ...|.||||.:|.
pombe   511 DGSPCGLLNHLARKCEIVTHPSD--VSQIPSLLLSLGVDPPS---VVGHESGWGCVQLDGKIVGW 570

  Fly   567 IHQSEAEKIVDELRYGKI-------FGT------LPQMMEIGFIPFKKNGQFPGLYIATGPARMM 618
            .....|:.:.|.||..||       .||      :|..:|||::|...|||:||||:.:.||||:
pombe   571 CTYKLAKHVADVLRLMKIEYAVKLRNGTATEPAKVPLDLEIGYVPPSHNGQYPGLYLFSNPARMV 635

  Fly   619 RPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRN 683
            |||.::....::.:|..||:||:||...||:.|..:||:|.:.|:.:|.:||:.|..|:||||||
pombe   636 RPVKHISTGELDMLGPFEQVYMDIACFPKEIVPKVSTHVEYSPTNVLSIVANMTPFSDFNQSPRN 700

  Fly   684 MYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTG 748
            ||||||||||||||......:..||||||||..||:.||..::...||.:..||||:||||||||
pombe   701 MYQCQMGKQTMGTPGTALRYRTDNKLYRLQTGQTPVVRPKLHNTYGLDHYPNGTNAVVAVISYTG 765

  Fly   749 YDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKS-------SYFARHPHMP---ELIKHLDTDG 803
            ||||||||:||:|:||||.||::||.:...|.:|.       .:|...|...   |.::.||.||
pombe   766 YDMEDAMILNKSAHERGFGYGTVYKGESFDLSQKRRRGEPVVHHFGFAPGSTPRREWLQKLDADG 830

  Fly   804 LPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKEDCIVESIRQLGSFDL--SPKKMVAITLRVPR 866
            ||..|.||..|.|:..|:|.......:......|...|:.:|.||: |:  |..:.:.:.||:.|
pombe   831 LPFIGIKLEDGDPIVAYYDESTGQNFIETYHGTEPGFVDEVRLLGN-DVGDSECQQIHVKLRITR 894

  Fly   867 PATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAI 931
            ...|||||:||.|||||||||:|..|:||||||:.|||:.|||.|||||||.|.||::|||..|.
pombe   895 SPIIGDKFSSRHGQKGICSQKWPTVDMPFTESGMQPDIIINPHAFPSRMTIGMFIESLAGKAGAC 959

  Fly   932 HGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHM 996
            ||...|:|||.:||:.||.||||:.|...||||:|.|.:|||:.|:||.|||:.|||:|||||||
pombe   960 HGLAQDSTPFIYSEQQTAADYFGEQLVKAGYNYHGNEPMYSGITGQEMKADIYIGVVYYQRLRHM 1024

  Fly   997 VFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVC 1061
            |.||:|||:||.:...|.||:|||||.||:|||||||||:|.||.:||:||||.:.||...:.||
pombe  1025 VSDKFQVRTTGPIHNLTRQPVKGRKRAGGIRFGEMERDAVIGHGTSFLMQDRLMNCSDYAQSWVC 1089

  Fly  1062 HKCGSILAPLQRIVKRNETGGLSSQPDTCRLCG-------DNSSV---------------SMIEI 1104
            ..||||:: :...:..|..|  |:....||.|.       |.|.:               ::|.:
pombe  1090 RDCGSIIS-IMSTISMNGVG--SASEVRCRSCAKPALGLEDTSDIWQDGSGKKFVGGTNTTLIAL 1151

  Fly  1105 PFSFKYLVTELSSVNI 1120
            |..|.||..||:::||
pombe  1152 PSVFNYLTAELTAMNI 1167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 487/1155 (42%)
RNA_pol_B_RPB2 35..1125 CDD:238353 487/1154 (42%)
RNA_pol_Rpa2_4 564..614 CDD:284335 21/63 (33%)
rpa2NP_595819.2 RpoB 10..1174 CDD:223163 492/1183 (42%)
RNA_pol_B_RPB2 29..1172 CDD:238353 488/1164 (42%)
RNA_pol_Rpb2_2 190..378 CDD:282427 67/189 (35%)
RNA_pol_Rpa2_4 568..631 CDD:284335 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 883 1.000 Inparanoid score I50
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1124430
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1173
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.