DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and Bloc1s3

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_808360.2 Gene:Bloc1s3 MGIID:2678952 Length:195 Species:Mus musculus

Alignment Length:147 Identity:33/148 (22%)
Similarity:52/148 (35%) Gaps:44/148 (30%)


  Fly   376 LPGHLYQKYLSERVESW-------VSQVRRCLQKKLTSPDALV---TSAVMTQCMRQAGGVGRAI 430
            ||..:.|:   :..|:|       ::..|..||.:|......:   .:|.::...|:||....|:
Mouse    74 LPPLVVQR---DPAETWGTEETPAMAPARSLLQLRLAESQTRLDHDVAAAVSGVYRRAGRDVAAL 135

  Fly   431 ESFLATGNIASRTGLGL-----MQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTTEARQLL 490
            ...||.   |..|||..     :....|..:||.::          |..|.           :||
Mouse   136 AGRLAA---AQATGLAAAHSVRLARGDLCALAERLD----------IVAGC-----------RLL 176

  Fly   491 PDAWGFICPVHTPDGTP 507
            ||..|  .|...|:..|
Mouse   177 PDIRG--VPGMEPEQDP 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 33/148 (22%)
RNA_pol_B_RPB2 35..1125 CDD:238353 33/148 (22%)
RNA_pol_Rpa2_4 564..614 CDD:284335
Bloc1s3NP_808360.2 BLOC1S3 13..180 CDD:292381 29/133 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.