DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and Polr2b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_722493.2 Gene:Polr2b MGIID:2388280 Length:1174 Species:Mus musculus

Alignment Length:1234 Identity:341/1235 (28%)
Similarity:547/1235 (44%) Gaps:257/1235 (21%)


  Fly    40 VDSFDEML------------TVGLDNSAKHMIPNHWLSPAGE-----KISMKVESIWIAKPK--- 84
            :|||||.:            .:.|...|:|        .:||     :..:|.|.|:::||.   
Mouse    44 LDSFDEFIQMSVQRIVEDAPPIDLQAEAQH--------ASGEVEEPPRYLLKFEQIYLSKPTHWE 100

  Fly    85 ---VPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSV---------NGVQKTPINMDLGEVP 137
               .|..::        |.::|..:::||....|.:..:|         ...|||.|    |::|
Mouse   101 RDGAPSPMM--------PNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFI----GKIP 153

  Fly   138 IMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRRNHPICVKRSSWKDR 200
            |||||..|.|...|..::.:..|...:.||.|:|.|:||  |.:..:.|...:....|.|.:...
Mouse   154 IMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYT 218

  Fly   201 GQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSH--VKRLSY----VPVCLILKCLMDYT 259
            |:..|   .|..:.|...:...:::.....|..|.....  |..|.|    ||:.::.:.|...:
Mouse   219 GECRS---CLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVS 280

  Fly   260 DEEIYNRLVQGYESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDD 321
            |.:|...::..:| |...:..|:..|.|   :|.:||     ..:|||:  |...|.|.: :...
Mouse   281 DRDILEHIIYDFE-DPEMMEMVKPSLDEAFVIQEQNV-----ALNFIGS--RGAKPGVTK-EKRI 336

  Fly   322 DVTDFILRERVMIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQ 382
            .....:|::.::.|:...:    .|...:.:|:.:|...|.|:.::::.|....:.:.|.|.|..
Mouse   337 KYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLA 401

  Fly   383 KYLSERVESWVSQVRRCLQKKL-TSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA------ 440
            .......::.:.:||...||.: ...|..:..|:.|:.      :...::..|||||..      
Mouse   402 FLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRI------ISDGLKYSLATGNWGDQKKAH 460

  Fly   441 -SRTGLGLMQNSGLVIMAENINRMRY---MSHFRAIH----RGSYFTTMRTTEARQLLPDAWGFI 497
             :|.|           :::.:||:.:   :||.|.::    |..     :..:.|||....||.:
Mouse   461 QARAG-----------VSQVLNRLTFASTLSHLRRLNSPIGRDG-----KLAKPRQLHNTLWGMV 509

  Fly   498 CPVHTPDGTPCGLLNHLTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRY 549
            ||..||:|...||:.:|.|...||:  :|.|           .|.:..|..:.|...        
Mouse   510 CPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATK-------- 566

  Fly   550 LGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIAT 612
                   :|::|..:| ||: :.|::::.||      .|.:.|:|  ..:...::.:...:.|.|
Mouse   567 -------IFVNGCWVG-IHK-DPEQLMNTLR------KLRRQMDIIVSEVSMIRDIREREIRIYT 616

  Fly   613 GPARMMRPVW-----------------------NLKWKR------VEYIGTLEQLYMEIA----- 643
            ...|:.||:.                       |..|:.      ||||.|||:..:.:|     
Mouse   617 DAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDD 681

  Fly   644 IDAKEM-YPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAAN 707
            :..||: |....||.|:..:..:...|::||.||:||||||.||..||||.||....|:..:...
Mouse   682 LQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDT 746

  Fly   708 KLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIY 772
            ..:.|..|..||......:.::..:...|.|:|||:.|||||:.||::|:|::|.:||| :.|::
Mouse   747 LAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGF-FRSVF 810

  Fly   773 KTKFLTLDKKSSY---------------FARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFD 822
            ...:...:.|..:               ..||    .:.:.||.|||..||.::|         .
Mouse   811 YRSYKEQESKKGFDQEEVFEKPTRETCQGMRH----AIYEKLDDDGLIAPGVRVS---------G 862

  Fly   823 GEVATYKVVKMDEKEDCIVESIRQLGSFDLSP---------------------KKMVAITLRVPR 866
            .:|...|.|.:.|.||.:..:.|:....|.|.                     .|...|.:|..|
Mouse   863 DDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVR 927

  Fly   867 PATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAI 931
            ...||||||||.||||.|..:|..||:|||..|:.|||:.|||..||||||..:||.:.||.:|.
Mouse   928 IPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSAN 992

  Fly   932 HGNVYDATPFRFSEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLR 994
            .|.:.|||||     |.|::.  ...:|...||:..|.|.||:|..||::|:.||.|..:||||:
Mouse   993 KGEIGDATPF-----NDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLK 1052

  Fly   995 HMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTL 1059
            |||.||...|:.|.::....||::||.|.||:||||||||..|:||||..|::|||..||.....
Mouse  1053 HMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVH 1117

  Fly  1060 VCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            ||:.|| |:|          .....:....||.|.:.:.:|::.:|::.|.|..||.|::|..|
Mouse  1118 VCNLCG-IMA----------IANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPR 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 341/1235 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 341/1235 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/52 (21%)
Polr2bNP_722493.2 PRK08565 27..1172 CDD:236291 341/1235 (28%)
RNA_pol_B_RPB2 39..1172 CDD:238353 341/1235 (28%)
RNA_pol_Rpb2_4 567..629 CDD:282431 16/70 (23%)
RNA_pol_Rpb2_5 653..700 CDD:282432 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.