DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and Polr1b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_033112.2 Gene:Polr1b MGIID:108014 Length:1135 Species:Mus musculus

Alignment Length:1154 Identity:518/1155 (45%)
Similarity:733/1155 (63%) Gaps:71/1155 (6%)


  Fly    17 SRPEFKQI--------PKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISM 73
            |.|..|.:        |::....|.:|...|||||:.....||.: |...||....:...|:||:
Mouse    12 SGPSLKHLTDPSYGIPPEQQKAALQDLTRAHVDSFNYAALEGLSH-AVQAIPPFEFAFKDERISL 75

  Fly    74 KVESIWIAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPI 138
            .:....|:.|.||:..| .:...:||.:.|....:|.|..:..:.|:||||.|..|...||.|||
Mouse    76 TIVDAVISPPSVPKGTI-CKDLNVYPAECRGRKSTYRGRLTADISWAVNGVPKGIIKQFLGYVPI 139

  Fly   139 MLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQN 203
            |::||.|||....|..:::|.|...|.||.|:|.|.||::||||:.|||.||.:.|..||.||..
Mouse   140 MVKSKLCNLYNLPPRVLIEHHEEAEEMGGYFIINGIEKVIRMLIVPRRNFPIAMVRPKWKSRGLG 204

  Fly   204 FSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLV 268
            ::..|:.::.|||:.|:::..:||:.|||....|.:.|.|.::|:...||.|:.::|.:|:..|:
Mouse   205 YTQFGVSMRCVREEHSAVNMNLHYVENGTVMLNFIYRKELFFLPLGFALKALVSFSDYQIFQELI 269

  Fly   269 QGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVM 333
            :|.|.|.::.:.|..|||.|..|..::..|..:::|..||.:. .:|:|.|:.:..:|:|.:.:.
Mouse   270 KGKEEDSFFRNSVSQMLRIVIEEGCHSQKQVLNYLGECFRVKL-SLPDWYPNVEAAEFLLNQCIC 333

  Fly   334 IHLDTYEDKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRR 398
            |||.:..|||.|:..|.:|||..|:|:...:|.||.:.||||.||.|:..:|.|::|:|:..::.
Mouse   334 IHLQSNTDKFYLLCLMTRKLFALARGECMDDNPDSLVNQEVLSPGQLFLMFLKEKMENWLVSIKI 398

  Fly   399 CLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRM 463
            .|.|:....:..:.:..:.:.......:.|..|..|||||:.|:||||.:|:|||.::|:.:|.:
Mouse   399 VLDKRAQKANVSINNENLMKIFSMGTELTRPFEYLLATGNLRSKTGLGFLQDSGLCVVADKLNFL 463

  Fly   464 RYMSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKL 528
            ||:||||.:|||:.|..||||..|:|||::|||:||||||||.|||||||||..||:.    .|.
Mouse   464 RYLSHFRCVHRGAAFAKMRTTTVRRLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVV----TKF 524

  Fly   529 V--KAIPKHLIDMGMMPLSN---RRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIF--G 586
            |  .:||..|..:|:.|:..   |.|  ...|.|.|||..:|.:.:..|.::.|.||..|:.  .
Mouse   525 VYTASIPALLCGLGVTPVDTAPCRPY--SDCYPVLLDGVMVGWVDKDLAPEVADTLRRFKVLREK 587

  Fly   587 TLPQMMEIGFIPFK-KNGQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMY 650
            .:|..||:..||.. |...:|||::.|.|.|::|||.||:..|.|.|||:|||:|.:||...|::
Mouse   588 RIPPWMEVALIPMTGKPSLYPGLFLFTTPCRLVRPVQNLELGREELIGTMEQLFMNVAIFEDEVF 652

  Fly   651 PDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTP 715
            ...:||.||.....:|.:||.||..|:||||||||||||||||||.|.|.:..::.|||||||||
Mouse   653 GGISTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQNRSDNKLYRLQTP 717

  Fly   716 GTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLD 780
            .:||.||..||...:|::.:|||||||||||||||||||||:|||::|||||:||:||::|:.|.
Mouse   718 QSPLVRPCMYDFYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFIDLS 782

  Fly   781 KK------SSYFARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYF-----DGEVATYKVVKMD 834
            :|      :..|...|..|.:::.||.||||..|:||.||.|.|.|.     :|.|..||     
Mouse   783 EKFKQGEDNLVFGVKPGDPRVMQKLDDDGLPFIGAKLEYGDPYYSYLNLNTGEGFVVYYK----- 842

  Fly   835 EKEDCIVESIR----QLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPF 895
            .||:|:|::|:    .:||   ...|.:.||:|:||..|||||||||.|||||.|:.:||||:||
Mouse   843 SKENCVVDNIKVCSNDMGS---GKFKCICITVRIPRNPTIGDKFASRHGQKGILSRLWPAEDMPF 904

  Fly   896 TESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAG 960
            ||||::|||:||||||||||||.|:||:||||.||:||..:|||||.|||||:|::|||:||:|.
Mouse   905 TESGMMPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALEYFGEMLKAA 969

  Fly   961 GYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGG 1025
            |||:|||||||||:.|.|:.||||.|||:||||||||.||:|||:|||.:..|:||:.||...||
Mouse   970 GYNFYGTERLYSGISGMELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPLGGRNVQGG 1034

  Fly  1026 VRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDT- 1089
            :||||||||||::||.:|||.||||:.||::...:|.:|||:|:||           |...|.: 
Mouse  1035 IRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHMCVECGSLLSPL-----------LEKPPPSW 1088

  Fly  1090 ---------CRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKLNEI 1129
                     |.:||.:.::..:.:|:.|:|.|.||:::||  :.||:.|
Mouse  1089 SAMRNRKYNCTVCGRSDTIDTVSVPYVFRYFVAELAAMNI--KVKLDVI 1135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 512/1127 (45%)
RNA_pol_B_RPB2 35..1125 CDD:238353 510/1123 (45%)
RNA_pol_Rpa2_4 564..614 CDD:284335 16/53 (30%)
Polr1bNP_033112.2 RpoB 35..1134 CDD:223163 513/1129 (45%)
RNA_pol_B_RPB2 38..1133 CDD:238353 512/1125 (46%)
RNA_pol_Rpb2_2 186..375 CDD:282427 67/190 (35%)
RNA_pol_Rpa2_4 563..616 CDD:284335 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56222172
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 987 1.000 Inparanoid score I307
Isobase 1 0.950 0 Normalized mean entropy S774
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1082665
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1173
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.