DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and rpc-2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_498192.2 Gene:rpc-2 WormBaseID:WBGene00017300 Length:1154 Species:Caenorhabditis elegans

Alignment Length:1197 Identity:341/1198 (28%)
Similarity:559/1198 (47%) Gaps:169/1198 (14%)


  Fly    19 PEFKQIPKKLSRHLANLGGPHVDSF--DEMLTVGLDNS--AKHMIPNHWLSPAGEKISMKVESIW 79
            |.|.::...:.:||.:.     |.|  :|:.::.|.|.  .....||.:|         |...|.
 Worm    33 PAFLKVRGLVKQHLVSF-----DHFVQEEIRSIMLSNQKITSDANPNFYL---------KYLDIR 83

  Fly    80 IAKPKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKA 144
            |.||. .::.:::...:|.|.:.|...::||...||.:.::....:....::.:|.:||||||..
 Worm    84 IGKPS-SEEGLNMTHDKITPQECRLRDMTYSAPISVDIEYTRGNQRVFKKDLIIGRMPIMLRSSK 147

  Fly   145 CNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGM 209
            |.|.....||:.:..|...:.||.||::|:||::.:.....:|. |.|.|:|.|       :|..
 Worm   148 CILRDLAEEELARVQECPYDPGGYFVVKGSEKVILIQEQLSKNR-IMVGRNSSK-------ELQC 204

  Fly   210 LVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESD 274
            .|.:...:..|.:    |:.....|:...|.:....|||.:|.|.:...:|.:|.:.:  |:|  
 Worm   205 EVLSSTSERKSKT----YVTMKKGKYSVRHNQLTDDVPVSIIFKAMGVESDFDIVSTI--GHE-- 261

  Fly   275 QYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRAR----FPEVPEWQ-------PDDDVTDFIL 328
            :.|||.....|.|..|..|||..|..:::.:..:||    |..:|...       .:.:..|| |
 Worm   262 EKYVSAFAQTLEESINAGVYTQQQALAYVTSKVKARKFTPFGSLPGTSVSVLTPPKEHEAVDF-L 325

  Fly   329 RERVMIHLDTYEDKFQL----IVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERV 389
            ...::.|:...:..|::    :..|.::|.|...|:..:::.|....:.:.|.|.|......:..
 Worm   326 SNSMITHIACPDGNFKMKAIYLGLMTRRLIQTELGENGLDDRDFYGNKRLELAGSLLSLLFEDVF 390

  Fly   390 ESWVSQVRR----CLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGN-IASRTGLGLMQ 449
            :.:.|:::|    .|.|.:.:|..:|      :.||| ..:...|.:.::||| |..|.   .|:
 Worm   391 KRFNSELKRIADNALMKTMAAPLDIV------KHMRQ-DMITNTIVNAMSTGNWIIKRF---RME 445

  Fly   450 NSGLVIMAENINRMRYMSHFRAIHR--GSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLN 512
            ..|   :.:.::|:.|:|....:.|  .::..|.:.:..|.|.|..||.:||..||:|..|||:.
 Worm   446 RLG---VTQVLSRLSYISALGMMTRINSTFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVK 507

  Fly   513 HLTLTCEISMRPDPKLVKAIPKHLIDMGMMPLSNRRYL---GEKLYVVFLDGKHLGHIHQSEAEK 574
            :|.|...|:...|.|.|..:   |::.|:..|.|..:.   ..:..::||:|..:|  ...:.|:
 Worm   508 NLALISHITTDSDEKPVLRL---LLNSGVEDLHNVHFSHVNKPENTLIFLNGVLIG--TAVDPER 567

  Fly   575 IVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRP---------------VWNL 624
            :|..:|..:..|.|.:     |:...::.....::|::...|:.||               |..|
 Worm   568 VVKAVRDLRRSGLLSE-----FVSVSRSLTNRSVFISSDGGRLCRPYIIVKNGTPMLTQAHVQEL 627

  Fly   625 KWKR-----------VEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYN 678
            |..:           |||:...|.....||:..:|:.|: |||||:.....:...|.|||.|.:|
 Worm   628 KEGKMIFEDFVDDGIVEYLDVNEMNDALIAVYGREIGPE-TTHLEIEPFTLLGVCAGLIPYPHHN 691

  Fly   679 QSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAV 743
            |||||.|||.||||.|||...|..|:..:.:|.|..|..||.:....:....:....|.|.|:||
 Worm   692 QSPRNTYQCAMGKQAMGTIAYNQQKRIDSIMYLLCYPQRPLVKSKTIELTNFEKLPAGANGIIAV 756

  Fly   744 ISYTGYDMEDAMIINKAAYERGFAYGSIYK------------------------------TKFLT 778
            :||:|||:|||:::|||:.:||:....:||                              .|...
 Worm   757 MSYSGYDIEDALVLNKASLDRGYGRCLVYKHVKGTAKKYPNQTFDRLLGPALDPNTRKPIFKHKN 821

  Fly   779 LDKKSSYFARHPHMPE---LIKHLD-TDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKEDC 839
            ||::...||....||:   :.||:. ..|...||:..|..:   ....|....||.|.:..|...
 Worm   822 LDQEGIVFAGARIMPKQTIINKHMPVVSGESGPGASASANT---IGIAGRQVDYKDVSITYKTPT 883

  Fly   840 IVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDI 904
            ...:.|.|.:::.....:..:.||..|...:||||:||.||||:|......||:||.:.|::||:
 Worm   884 PSYAERVLLTYNEDEAHLFKVLLRQTRRPELGDKFSSRHGQKGVCGLIAQQEDMPFNDLGMVPDM 948

  Fly   905 VFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTER 969
            :.||||:|||||:..::|.::||...::|..:..|.|...:.....:    .|.|.||||.|.:.
 Worm   949 IMNPHGYPSRMTVGKLMELLSGKAGVVNGTYHYGTAFGGDQVKDVCE----ELAACGYNYMGKDM 1009

  Fly   970 LYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERD 1034
            |.||:.|:.::|.|:||.::||:|:|||.||...|:.|...|.|.||.:||.|.||:|.||||||
 Worm  1010 LTSGITGQPLSAYIYFGPIYYQKLKHMVLDKMHARARGPRAALTRQPTEGRSREGGLRLGEMERD 1074

  Fly  1035 ALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSV 1099
            .||::||:.||.:||..:||:....||..||.|                 .....|:.|..:.|:
 Worm  1075 CLIAYGASMLLIERLMVSSDEFKVDVCTGCGVI-----------------GSKGWCQKCRSSKSM 1122

  Fly  1100 SMIEIPFSFKYLVTELSSVNINARFKL 1126
            :.|:||::.|.|..||.|:||..|..|
 Worm  1123 ANIKIPYACKLLFQELQSMNIVPRLDL 1149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 337/1183 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 336/1179 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 8/50 (16%)
rpc-2NP_498192.2 PRK08565 28..1150 CDD:236291 341/1198 (28%)
RNA_pol_B_RPB2 41..1148 CDD:238353 338/1187 (28%)
RNA_pol_Rpb2_4 552..613 CDD:282431 14/68 (21%)
RNA_pol_Rpb2_5 634..674 CDD:282432 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.