DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and rpb-2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_498047.2 Gene:rpb-2 WormBaseID:WBGene00016140 Length:1194 Species:Caenorhabditis elegans

Alignment Length:1212 Identity:339/1213 (28%)
Similarity:536/1213 (44%) Gaps:214/1213 (18%)


  Fly    40 VDSFDEMLTVGLDNSAKHMIP------NHWL-----SPAGEKISMKVESIWIAKPKVPQDVIDVR 93
            :|||||.:.:.:....:...|      |..|     :||  |.|:|...|:::||...:.  |..
 Worm    52 LDSFDEFVQMNVQRIVEDSPPVELQSENQHLGTDMENPA--KFSLKFNQIYLSKPTHWEK--DGA 112

  Fly    94 TREIYPTDSRQLHVSYSGMCSVRLGWSV----NGVQKTPINMDLGEVPIMLRSKACNLGQATPEE 154
            ...:.|.::|..:::|:....|.:...|    :..:|....:.:|:||:||||..|.|...|..:
 Worm   113 PMPMMPNEARLRNLTYASPLYVDITKVVTRDDSATEKVYDKVFVGKVPVMLRSSYCMLSNMTDRD 177

  Fly   155 MVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSD--LGMLVQTVRED 217
            :.:..|...:.||.|||.|:||:   ||...:.....|...|.||....|..  ...|..:.|..
 Worm   178 LTELNECPLDPGGYFVINGSEKV---LIAQEKMATNTVYVFSMKDGKYAFKTECRSCLENSSRPT 239

  Fly   218 ESSLSNVVHYLNNGTAKF--------MFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESD 274
            .:...|::.....|..|.        :..::|:  .:|:.::.:.|...:|.:|...::..: :|
 Worm   240 STMWVNMLARGGGGGKKTAMGQRIIGILPYIKQ--EIPIMIVFRALGFVSDRDILGHIIYDF-ND 301

  Fly   275 QYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHL 336
            ...:..|:..|.|   :|.:||     ..:|||  .|...|.|...|......: ||::.::.|:
 Worm   302 PEMMEMVKPSLDEAFVIQEQNV-----ALNFIG--ARGAKPGVTREQRIKYARE-ILQKELLPHV 358

  Fly   337 DTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVR 397
            ...|    .|...|.:|:.:|...|.|:.::::.|....:.:.|.|.|..........:.:.::|
 Worm   359 GVSEHCETKKAFFIGYMVHRLLLAALGRRELDDRDHIGNKRLDLAGPLLAFLFRSLFRNLLKEMR 423

  Fly   398 RCLQKKLTSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA-------SRTGLGLMQNSGLVI 455
            ...||.:...|    ...:..|:: ...:.|.:...|||||..       ||.|           
 Worm   424 MTAQKYINKND----DFALDVCVK-TSTITRGLTYSLATGNWGDQKKAHQSRAG----------- 472

  Fly   456 MAENINRMRY---MSHFR----AIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNH 513
            :::.:||:.|   :||.|    .|.|..     :..:.|||....||.:||..||:|...||:.:
 Worm   473 VSQVLNRLTYTATLSHLRRANSPIGREG-----KLAKPRQLHNTQWGMVCPAETPEGQAVGLVKN 532

  Fly   514 LTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRYLGEKLYVVFLDGKHLG 565
            |.|...||:  .|:|           .|.:..|..:.|...               :|::|..:|
 Worm   533 LALMAYISVGSLPEPILEFLEEWSMENLEEVSPSAIADATK---------------IFVNGAWVG 582

  Fly   566 HIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIATGPARMMRP---VWNLK 625
             ||: |.::::..|:      .|.:.|:|  ..:...::.:...:.|.|...|:.||   |.|.|
 Worm   583 -IHR-EPDQLMTTLK------KLRRQMDIIVSEVSMVRDIRDREIRIYTDAGRVCRPLLIVENQK 639

  Fly   626 ----------------------WKR------VEYIGTLEQLYMEIAIDAKEM----YPDFTTHLE 658
                                  |..      ||.|.::|:....||:..:::    |.|..||.|
 Worm   640 LALKKRHIDQLKEAADEANKYTWSDLVGGGVVELIDSMEEETSMIAMMPEDLRSGGYCDTHTHCE 704

  Fly   659 LAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPV 723
            :.....:...|::||.||:||||||.||..||||.||....|:..:.....:.|..|..||....
 Worm   705 IHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYTTNFHVRMDTLAHVLYYPQKPLVTTR 769

  Fly   724 HYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSI----YKTKFLTLDKKSS 784
            ..:.::.::...|.|||||::||:||:.||::|:|.:|.:||. :.|:    |:.....||..:.
 Worm   770 SMEYLRFNELPAGINAIVAILSYSGYNQEDSVIMNNSAIDRGL-FRSVFYRSYRDNEANLDNANE 833

  Fly   785 YFARHPHMPE-------LIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKEDCIVE 842
            .....|...:       |...||.||:..||.::|         ..:|...|.|.:.:.:|.:..
 Worm   834 ELIEKPTREKCSGMRHSLYDKLDEDGIISPGMRVS---------GDDVIIGKTVALPDIDDDLDA 889

  Fly   843 SIRQLGSFDLSP---------------------KKMVAITLRVPRPATIGDKFASRAGQKGICSQ 886
            |.::....|.|.                     .|.|.|.:|..|...||||||||.||||....
 Worm   890 SGKKYPKRDASTFLRSSETGIVDQVMLSLNSDGNKFVKIRMRSVRLPQIGDKFASRHGQKGTMGI 954

  Fly   887 KYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAID 951
            .|..||:|||..||.|||:.|||..||||||..:||.:.||.:|..|.:.|||||   .:...:.
 Worm   955 MYRQEDMPFTAEGLTPDIIINPHAVPSRMTIGHLIECLQGKLSANKGEIGDATPF---NDTVNVQ 1016

  Fly   952 YFGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQP 1016
            ....:|...||:..|.|.:|:|..|:::|..||||..:||||:|||.||...|:.|.::....||
 Worm  1017 KISGLLCEYGYHLRGNEVMYNGHTGKKLTTQIFFGPTYYQRLKHMVDDKIHSRARGPIQMMNRQP 1081

  Fly  1017 IKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETG 1081
            ::||.|.||:||||||||..|||||...|::|||..||..|..||:.||.|:           ..
 Worm  1082 MEGRARDGGLRFGEMERDCQISHGATQFLRERLFEVSDPYHVYVCNNCGLIV-----------VA 1135

  Fly  1082 GLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            .|.:....|:.|.:.:.||.:.||::.|.|..||.|::|..|
 Worm  1136 NLRTNSFECKACRNKTQVSAVRIPYACKLLFQELMSMSIAPR 1177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 339/1213 (28%)
RNA_pol_B_RPB2 35..1125 CDD:238353 339/1213 (28%)
RNA_pol_Rpa2_4 564..614 CDD:284335 10/52 (19%)
rpb-2NP_498047.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.