DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and rpoa-2

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_492476.1 Gene:rpoa-2 WormBaseID:WBGene00008781 Length:1127 Species:Caenorhabditis elegans

Alignment Length:1124 Identity:482/1125 (43%)
Similarity:690/1125 (61%) Gaps:56/1125 (5%)


  Fly    39 HVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAKP------KVPQDVIDVRTREI 97
            ||||||.:::.|...:|:.:....:....|:.::||..|..:.||      |:..|     |..:
 Worm     9 HVDSFDFLVSKGCQFAAQAVPAEKFRLKNGDAVTMKFTSAQLHKPTLDTGAKLTSD-----TLPL 68

  Fly    98 YPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKACNLGQATPEEMVKHGEHD 162
            .|.:.||..::|:|...|.:...|||.:...|.:.||:|||||||:.|:|...:.:|:|..||..
 Worm    69 LPAECRQRGLTYAGNLKVGIDVHVNGSRLDIIEIILGKVPIMLRSEGCHLRGMSRKELVVAGEEP 133

  Fly   163 SEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNVVHY 227
            .|.||.|::.|:||::|:||..|||.||.:.|.::|::|:.||:.|:::::|:|:.:::...:||
 Worm   134 IEKGGYFIVNGSEKVIRLLIANRRNFPIAIIRKTFKEKGKLFSEFGVMMRSVKENHTAVMMTLHY 198

  Fly   228 LNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNEN 292
            |:.||.:......:.:.|||:..|:|.|.|..|..|.....:|...||:|.||:..||.:.|.|.
 Worm   199 LDTGTMQLALQFRREIFYVPLMYIVKALTDKNDAVISAGFKRGRNQDQFYSSCILNMLAQCQEEE 263

  Fly   293 VYTHAQCKSFIGNLFRARFPE-VPEWQPDDDVTDFILRERVMIHLDTYEDKFQLIVFMIQKLFQC 356
            :.........||:.||....: |..|:.|.:...||:||.|:||||:.|:||..:.:|.|||...
 Worm   264 ILNQEAAIRAIGSRFRVAVSDRVAPWEDDLEAGRFIIRECVLIHLDSDEEKFHTLAYMTQKLIAL 328

  Fly   357 AQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCM- 420
            .:|:...|..|:...||..:.||:....|.||:|:.:..|||.|:...:..|.::|||.:.:.: 
 Worm   329 VKGECAPETPDNPQFQEASVSGHILLLILRERMENIIGMVRRKLEYMSSRKDFILTSAAILKALG 393

  Fly   421 -RQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTMRTT 484
             ...|.:.|.:..||||||:.:|.||.|.|.||..::||.||::|::|||||||||::|..||||
 Worm   394 NHTGGEITRGMAYFLATGNLVTRVGLALQQESGFSVIAERINQLRFVSHFRAIHRGAFFMEMRTT 458

  Fly   485 EARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMGMM------- 542
            :.|:|.|:|||||||||||||.|||||||:|.:|.|.  .|......:|..|.::||.       
 Worm   459 DVRKLRPEAWGFICPVHTPDGAPCGLLNHVTASCRIV--TDLSDNSNVPSLLAELGMYTHKTVAL 521

  Fly   543 --PLSNRRYLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIF--GTLPQMMEIGFIPFK--- 600
              |       ||:||.|.::|:.||::..::|..|...||..|:.  ..:|...||..:...   
 Worm   522 APP-------GEELYPVLMNGRFLGYVPITKAASIERYLRCAKVAKDARIPYTSEIALVRRSTDI 579

  Fly   601 KN--GQFPGLYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTH 663
            ||  .|:||:||.:...|::|||.||....||:|||.||:|:.:.:|.:|..|..|.|.||..:.
 Worm   580 KNIQTQYPGIYILSDAGRLIRPVRNLAMDAVEHIGTFEQVYLSVVLDPEEAEPGVTMHQELHPSC 644

  Fly   664 FMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNI 728
            ..|...||||.||:||||||:||||||||||||....|..:|.||:||||.|..|:.:...|:..
 Worm   645 LFSFAGNLIPFPDHNQSPRNVYQCQMGKQTMGTAVHAWHSRADNKMYRLQFPQQPMLKLEAYEKY 709

  Fly   729 QLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTK---FLTLDKKSSYFARHP 790
            ::|::.:||||.|||||||||||||||.||||:|:||||:|::.|.:   .:|..::.:.|.|:|
 Worm   710 EMDEYPLGTNACVAVISYTGYDMEDAMTINKASYQRGFAHGTVIKVERINLVTERERKTIFYRNP 774

  Fly   791 HMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMDEKED--CIVESIRQLGSFDLS 853
            .  |.||.:..||||.||.:.......|..|:.|...::..|....|.  |.:..|.:.|..| |
 Worm   775 R--EEIKTVGPDGLPIPGRRYFLDEVYYVTFNMETGDFRTHKFHYAEPAYCGLVRIVEQGEGD-S 836

  Fly   854 PKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIA 918
            ..|...|..|:.|...||||||||.|||||.|..:|.|.|||:|:|::|||:||||||||||||.
 Worm   837 GAKHALIQWRIERNPIIGDKFASRHGQKGINSFLWPVESLPFSETGMVPDIIFNPHGFPSRMTIG 901

  Fly   919 MMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMTADI 983
            ||||:||||.||.||..|||:||.|:|:||||::||::|...||||||.|..|||||||:|...|
 Worm   902 MMIESMAGKAAATHGENYDASPFVFNEDNTAINHFGELLTKAGYNYYGNETFYSGVDGRQMEMQI 966

  Fly   984 FFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDR 1048
            |||:|:|||||||:.||:|||:||.::..||||:||||:|||:|||||||||:|:||.:|:||||
 Worm   967 FFGIVYYQRLRHMIADKFQVRATGPIDPITHQPVKGRKKGGGIRFGEMERDAIIAHGTSFVLQDR 1031

  Fly  1049 LFHNSDKTHTLVCHKCGSILAPLQRI--------VKRNETGGLS-SQPDTCRLCGDNSSVSMIEI 1104
            |.:.||:.....|.:|||:|:.|...        .||.:...|. ::...||.|..:..|.::::
 Worm  1032 LLNCSDRDVAYACRRCGSLLSVLMSSRAGSHLLKKKRKDDEPLDYTETQRCRTCDKDDQVFLLQV 1096

  Fly  1105 PFSFKYLVTELSSVNINAR 1123
            |..|:||..||:::|:..:
 Worm  1097 PRVFRYLTAELAAMNVKIK 1115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 482/1125 (43%)
RNA_pol_B_RPB2 35..1125 CDD:238353 482/1125 (43%)
RNA_pol_Rpa2_4 564..614 CDD:284335 17/57 (30%)
rpoa-2NP_492476.1 RNA_pol_B_RPB2 5..1116 CDD:238353 482/1125 (43%)
RpoB 9..1116 CDD:223163 482/1125 (43%)
RNA_pol_Rpb2_2 <216..339 CDD:282427 44/123 (36%)
RNA_pol_Rpa2_4 538..595 CDD:284335 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56231026
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 890 1.000 Inparanoid score I198
Isobase 1 0.950 0 Normalized mean entropy S774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T477352
orthoMCL 1 0.900 OOG5_127929
Panther 1 1.100 LDO PTHR20856
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1173
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.