DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr1b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:XP_002940442.1 Gene:polr1b XenbaseID:XB-GENE-1008539 Length:1135 Species:Xenopus tropicalis

Alignment Length:1132 Identity:500/1133 (44%)
Similarity:726/1133 (64%) Gaps:59/1133 (5%)


  Fly    29 SRH--LANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGEKISMKVESIWIAKPKVPQDVID 91
            |:|  |.::...|:|||::.:|.||..:.:.|.|..: :...:|:::::....|..|.||:..| 
 Frog    30 SQHPPLQDITRAHIDSFNQAMTEGLSLAVQAMKPLEF-TYKNDKVALQIVDAVITPPLVPKGSI- 92

  Fly    92 VRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQKTPINMDLGEVPIMLRSKACNLGQATPEEMV 156
            .:.::|||.:.|....:|.|..:..:.||:||:||..|...||.:|||::||.|||....|::::
 Frog    93 CKEQKIYPAECRGRRSTYRGKLTADVSWSLNGLQKGIIKQTLGHIPIMVKSKFCNLYDLNPKQLL 157

  Fly   157 KHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSL 221
            :|.|.:.|.||.|:|.|.||::|||||.|||.||.:.|..||:||..::..|:.::.||::.:::
 Frog   158 EHHEEEQEMGGYFIINGIEKVIRMLIMPRRNFPIAMIRPKWKNRGPGYTQYGISLRCVRDEHTAV 222

  Fly   222 SNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLR 286
            :..:|||.||:....|.:.|.|.::|:...||.|:||:|.:|:..|::|.|.:.:|..|:..|||
 Frog   223 NMNLHYLENGSVMVNFIYQKELFFIPLGFALKALVDYSDYQIFTELIKGKEENSFYRDCMTQMLR 287

  Fly   287 EVQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHLDTYEDKFQLIVFMIQ 351
            .|..|..::......::|..||.:| .:|:|..|:...:|::.:.:.|||.|..:||.::..|.|
 Frog   288 AVVEEGCHSQKNVLKYLGERFRVKF-YLPDWFTDEQAAEFLISQCICIHLKTNVEKFYMLCMMTQ 351

  Fly   352 KLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVM 416
            |||..|:.....||.||.|.|||:.||.|...:|.|::|||:..|:..|.|:.......:::..|
 Frog   352 KLFTFAKDGCMEENPDSLMYQEVMTPGQLLLMFLKEKMESWLLGVKVNLDKRAHKYTVDLSTETM 416

  Fly   417 TQCMRQAGGVGRAIESFLATGNIASRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHRGSYFTTM 481
            .:.......:.:..|..|||||:.|:||||::|:||||::|:.:|.:||:||||.:|||:.|..|
 Frog   417 MKVFTSTSDLTKTCEYLLATGNLRSKTGLGMLQSSGLVVVADKLNFIRYLSHFRCVHRGAAFAKM 481

  Fly   482 RTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISMRPDPKLVKAIPKHLIDMGMMPLSN 546
            |||..|:|||::|||:||||||||.||||:||:|..|||..:.....:  :|..|..:||.|:..
 Frog   482 RTTSVRRLLPESWGFLCPVHTPDGEPCGLMNHMTAACEIVTQTSYNTL--LPLLLCSLGMTPVDG 544

  Fly   547 RR-YLGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKI--FGTLPQMMEIGFIPFK-KNGQFPG 607
            .. .|....|.|.|||..:|.:.::.|..:|..||..|:  ...:|...||..||.. |...:||
 Frog   545 TAGKLFADCYPVMLDGAMVGWVEKTIAPGLVSALRNYKVKHEKNVPPWTEIVLIPMTGKASLYPG 609

  Fly   608 LYIATGPARMMRPVWNLKWKRVEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFMSNLANLI 672
            |::.|.|.||:|||.||...:.|.:|||||:::.:|:...::.|..|||.|......:|.:||.|
 Frog   610 LFLFTTPCRMVRPVRNLALGKEELLGTLEQVFLNVAVYEGDIVPGETTHQEFFPHSMLSVVANFI 674

  Fly   673 PMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGT 737
            |..|:||||||||||||||||||.|.:.:..::.|||||||||.:||.||..||..::|::.:||
 Frog   675 PFSDHNQSPRNMYQCQMGKQTMGFPLMTYQDRSDNKLYRLQTPQSPLVRPSMYDYYEMDNYPIGT 739

  Fly   738 NAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKK------SSYFARHPHMPELI 796
            ||||||||||||||||||::||:::|||||:||:|||..:.|.||      :..|...|....:.
 Frog   740 NAIVAVISYTGYDMEDAMVLNKSSWERGFAHGSVYKTDHVDLSKKLKDGEDNLVFGIKPDDERVK 804

  Fly   797 KHLDTDGLPHPGSKLSYGSPLYCYFD---GE--VATYKVVKMDEKEDCIVESIR------QLGSF 850
            ..||:||||..|:.|.:|.|.|.|.:   ||  ||.||     .||:|::::|:      ..|.|
 Frog   805 GRLDSDGLPAVGAVLQFGDPYYGYLNLNTGESFVAYYK-----SKENCVIDNIKICSNDIGFGKF 864

  Fly   851 DLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRM 915
                 |.|.:|:|:||..|||||||||.|||||.|:.:|:||:||||||::|||:||||||||||
 Frog   865 -----KSVCVTMRIPRNPTIGDKFASRHGQKGILSRLWPSEDMPFTESGMVPDILFNPHGFPSRM 924

  Fly   916 TIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDYFGKMLEAGGYNYYGTERLYSGVDGREMT 980
            ||.|:||:||||.||:||..:|||||.|||||:|::|||:||.|||||:||||:||||:.|.|:.
 Frog   925 TIGMLIESMAGKSAALHGLCHDATPFTFSEENSALEYFGEMLRAGGYNFYGTEKLYSGISGLELE 989

  Fly   981 ADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLL 1045
            ||||.|||:||||||||.||:|||:|||.:..|:||:.||...||:||||||||||::||.:|||
 Frog   990 ADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPVGGRNVQGGIRFGEMERDALLAHGTSFLL 1054

  Fly  1046 QDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDT----------CRLCGDNSSVS 1100
            .||||:.||::...||.:|||:|:|.           |...|.:          |.:|....:|.
 Frog  1055 HDRLFNCSDRSTAHVCIECGSLLSPF-----------LEKPPPSWSSIRNRKHHCEVCDRTDTVE 1108

  Fly  1101 MIEIPFSFKYLVTELSSVNINARFKLN 1127
            .:.:|:.|:|.|.||:::||:.:..::
 Frog  1109 TVSVPYVFRYFVAELAAMNISVKLSVS 1135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 497/1126 (44%)
RNA_pol_B_RPB2 35..1125 CDD:238353 497/1121 (44%)
RNA_pol_Rpa2_4 564..614 CDD:284335 16/53 (30%)
polr1bXP_002940442.1 RpoB 33..1132 CDD:223163 498/1125 (44%)
RNA_pol_B_RPB2 38..1132 CDD:238353 497/1120 (44%)
RNA_pol_Rpb2_2 186..374 CDD:282427 66/189 (35%)
RNA_pol_Rpa2_4 563..616 CDD:284335 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56224002
eggNOG 1 0.900 E1_COG0085
Hieranoid 1 1.000
Homologene 1 1.000 H7133
Inparanoid 1 1.050 970 1.000 Inparanoid score I293
OMA 1 1.010
OrthoDB 1 1.010 D42570at2759
OrthoFinder 1 1.000 FOG0003926
OrthoInspector 1 1.000 T1058692
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1173
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.