DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr2b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:XP_002937598.2 Gene:polr2b XenbaseID:XB-GENE-1012874 Length:1174 Species:Xenopus tropicalis

Alignment Length:1222 Identity:332/1223 (27%)
Similarity:540/1223 (44%) Gaps:233/1223 (19%)


  Fly    40 VDSFDEMLTVGLDNSAKHMIP-------NHWLSPAGE--KISMKVESIWIAKPK------VPQDV 89
            :|||||.:.:.:....:...|       .|......|  :..:|.|.|:::||.      .|..:
 Frog    44 LDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTTGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPM 108

  Fly    90 IDVRTREIYPTDSRQLHVSYSGMCSVRLGWSV-----NGVQKTPINMDLGEVPIMLRSKACNLGQ 149
            :        |.::|..:::||....|.:..:|     ..:|.......:|::||||||..|.|..
 Frog   109 M--------PNEARLRNLTYSAPLYVDITKTVVKEGEEQIQTQHQKTFIGKIPIMLRSTYCLLNG 165

  Fly   150 ATPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQ 212
            .|..::.:..|...:.||.|:|.|:||  |.:..:.|...:....|.|.:....:..|   .|..
 Frog   166 LTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRS---CLEN 227

  Fly   213 TVREDESSLSNVVHYLNNGTAKFMFSH--VKRLSY----VPVCLILKCLMDYTDEEIYNRLVQGY 271
            :.|...|...:::.....|..|.....  |..|.|    ||:.::.:.|...:|.:|...::..:
 Frog   228 SSRPTSSIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDF 292

  Fly   272 ESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVM 333
            | |...:..|:..|.|   :|.:||     ..:|||:  |...|.|.: :........:|::.::
 Frog   293 E-DPEMMEMVKPSLDEAFVIQEQNV-----ALNFIGS--RGAKPGVTK-EKRIKYAKEVLQKEML 348

  Fly   334 IHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQKYLSERVESWVS 394
            .|:...:    .|...:.:|:.:|...|.|:.::::.|....:.:.|.|.|.........::.:.
 Frog   349 PHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLK 413

  Fly   395 QVRRCLQKKL-TSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA-------SRTGLGLMQNS 451
            :||...||.: ...|..:..|:.|:.      :...::..|||||..       :|.|       
 Frog   414 EVRIYAQKFIDRGKDFNLELAIKTRI------ISDGLKYSLATGNWGDQKKAHQARAG------- 465

  Fly   452 GLVIMAENINRMRY---MSHFRAIH----RGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCG 509
                :::.:||:.:   :||.|.::    |..     :..:.|||....||.:||..||:|...|
 Frog   466 ----VSQVLNRLTFASTLSHLRRLNSPIGRDG-----KLAKPRQLHNTLWGMVCPAETPEGHAVG 521

  Fly   510 LLNHLTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRYLGEKLYVVFLDG 561
            |:.:|.|...||:  :|.|           .|.:..|..:.|...               :|::|
 Frog   522 LVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATK---------------IFVNG 571

  Fly   562 KHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIATGPARMMRPVW-- 622
            ..:| ||: :.|::::.||      .|.:.|:|  ..:...::.:...:.|.|...|:.||:.  
 Frog   572 CWVG-IHK-DPEQLMNTLR------KLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIV 628

  Fly   623 ---------------------NLKWKR------VEYIGTLEQLYMEIAIDAKEM------YPDFT 654
                                 |..|:.      ||||.|||:..:.:|:...::      |....
 Frog   629 EKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTY 693

  Fly   655 THLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPL 719
            ||.|:..:..:...|::||.||:||||||.||..||||.||....|:..:.....:.|..|..||
 Frog   694 THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPL 758

  Fly   720 FRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSS 784
            ......:.::..:...|.|:|||:.|||||:.||::|:|::|.:||| :.|::...:...:.|..
 Frog   759 VTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGF-FRSVFYRSYKEQESKKG 822

  Fly   785 Y---------------FARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFDGEVATYKVVKMD 834
            :               ..||    .:...||.|||..||.::|         ..:|...|.|.:.
 Frog   823 FDQEEVFEKPTRETCQGMRH----AIYDKLDDDGLIAPGVRVS---------GDDVIIGKTVTLP 874

  Fly   835 EKEDCIVESIRQLGSFDLSP---------------------KKMVAITLRVPRPATIGDKFASRA 878
            |.||.:..:.|:....|.|.                     .|...|.:|..|...||||||||.
 Frog   875 ENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRH 939

  Fly   879 GQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRF 943
            ||||.|..:|..||:|||..|:.|||:.|||..|||||:..:||.:.||.:|..|.:.|||||  
 Frog   940 GQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPF-- 1002

  Fly   944 SEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRST 1006
               |.|::.  ...:|...||:..|.|.||:|..||::|:.||.|..:||||:|||.||...|:.
 Frog  1003 ---NDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRAR 1064

  Fly  1007 GAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPL 1071
            |.::....||::||.|.||:||||||||..|:||||..|::|||..||.....||:.||.:....
 Frog  1065 GPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIAN 1129

  Fly  1072 QRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINAR 1123
            .|           :....||.|.:.:.:|::.:|::.|.|..||.|::|..|
 Frog  1130 TR-----------THTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPR 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 332/1223 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 332/1223 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/52 (21%)
polr2bXP_002937598.2 PRK08565 27..1172 CDD:236291 332/1223 (27%)
RNA_pol_B_RPB2 39..1172 CDD:238353 332/1223 (27%)
RNA_pol_Rpb2_4 567..629 CDD:282431 16/70 (23%)
RNA_pol_Rpb2_5 653..700 CDD:282432 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.