DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr3b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001121521.1 Gene:polr3b XenbaseID:XB-GENE-5799940 Length:1134 Species:Xenopus tropicalis

Alignment Length:1205 Identity:353/1206 (29%)
Similarity:557/1206 (46%) Gaps:169/1206 (14%)


  Fly     5 MQQMKTIPVLTNSRPEFKQIPKKLSRHLANLGGPHVDSFDEMLTVGLDNSAKHMIPNHWLSPAGE 69
            :.|.:.|..:...:.::|.:|..|.  :..|...|:|||:..:.   |...|.|       .|.|
 Frog    11 LSQEELIAPVDTVQEKWKLLPAFLK--VKGLVKQHIDSFNYFIN---DEIKKIM-------KANE 63

  Fly    70 KISMKVESIWIAK--------PKVPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSVNGVQK 126
            |::...:.:|..|        |.| ::..:| ||.:.|.:.|...::||...:|.:.:: .|.|:
 Frog    64 KVTSDADPMWYLKYLNIYVGLPDV-EESFNV-TRPVSPHECRLRDMTYSAPITVDIEYT-RGSQR 125

  Fly   127 TPIN-MDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPI 190
            ...| :.:|.:||||||..|.|...||.|..|..|...:.||.|:::|.||::.:.....:|..|
 Frog   126 IIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRII 190

  Fly   191 CVKRSSWKDRGQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSHVKRLSYVPVCLILKCL 255
            .        .......:|..|.:...::.|.:|:|  :..|  :|...|......:|:.:|.|.:
 Frog   191 V--------EADRKGTVGASVTSSTHEKKSRTNLV--VKQG--RFYLKHNTLTEDIPIAIIFKAM 243

  Fly   256 MDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNENVYTHAQCKSFIGNLFRAR---FPEVPEW 317
            ...:|:||    ||...::::.::.....|.|.|...::|..|...||||..|.:   ....|:.
 Frog   244 GVESDQEI----VQMIGTEEHVIAAFAPSLEECQKAQIFTQMQALKFIGNKVRRQRMWGSSGPKK 304

  Fly   318 QPDDDVTDFILRERVMIHLDTYEDKFQ----LIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPG 378
            ...|:..: :|...::.|:...|..|:    .|..|::::. .|||..||::.|....:.:.|.|
 Frog   305 SKIDEARE-LLASTILTHVPVKEFHFRTKCIYIAVMVRRVI-LAQGANKVDDRDYYGNKRLELAG 367

  Fly   379 HLYQKYLSERVESWVSQVRRCLQKKLTSPDALVTSAVMTQCMRQ---AGGVGRAIESFLATGNIA 440
            .|......:..:.:.|::::...:.:  |........:.:.|||   ..|:..||.|    ||.:
 Frog   368 QLLSLLFEDLFKKFNSEMKKIADQVI--PKQRAAQFDVVKHMRQDQITNGMVNAISS----GNWS 426

  Fly   441 SRTGLGLMQNSGLVIMAENINRMRYMSHFRAIHR--GSYFTTMRTTEARQLLPDAWGFICPVHTP 503
            .:.  ..|...|   :.:.::|:.|::....:.|  ..:..|.:.:..|.|.|..||.:||..||
 Frog   427 LKR--FKMDRQG---VTQVLSRLSYIAALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTP 486

  Fly   504 DGTPCGLLNHLTLTCEIS--MRPDPKLVKAIPKHLIDMGMMPLSNRRYLGEKL-----YVVFLDG 561
            :|..|||:.:|.|...|:  |...|.:..|....:.|:.::       .||:|     ::|||:|
 Frog   487 EGEACGLVKNLALMTHITTDMEDGPIIKLAANLGVEDVNLL-------CGEELSYANVFLVFLNG 544

  Fly   562 KHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRPVWNLKW 626
            ..||.|.  :.:|:|:..|..:..|.:.:     |:....|.....:||::...|:.||...:|.
 Frog   545 NILGVIR--DHQKLVNTFRLMRRAGYINE-----FVSISTNISDRCVYISSDGGRLCRPYIIVKN 602

  Fly   627 KR--------------------------VEYIGTLEQLYMEIAIDAKEMYPDFTTHLELAKTHFM 665
            :|                          |||:...|:....:|: .:......|||||:.....:
 Frog   603 QRSAVTNKHIQELSQGYRSFEDFLHESLVEYLDVNEENDCNVAL-YEHTITKHTTHLEIEPFTLL 666

  Fly   666 SNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAANKLYRLQTPGTPLFRPVHYDNIQL 730
            ...|.|||.|.:||||||.|||.||||.|||...|...:....:|.|..|..|:.:....:.|:.
 Frog   667 GVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIEF 731

  Fly   731 DDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKKSSYFARHPHMP-- 793
            :....|.||.|||:||:|||:|||:::|||:.:|||....:||....||.:.|:........|  
 Frog   732 EKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYSNQTFDKVMGPML 796

  Fly   794 ------ELIKH--LDTDGLPHPGSKLS-------------YGSPLYCYFDGEVATYKVVKMDEK- 836
                  ::.:|  ||.||:..||.|:.             ..:||......:...||.|.:..| 
 Frog   797 DANTRKQIWRHEILDADGICSPGEKVENKQVLVNKYMPTVTQTPLEGSSVPQQPQYKDVPITYKG 861

  Fly   837 -EDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGL 900
             .|..:|.:  :.|.:.....::.|.||..|...|||||:||.||||:|....|.||:||.|:|:
 Frog   862 PTDSYIEKV--MISSNAEDAFLIKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCETGI 924

  Fly   901 IPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTA----IDYFGKMLEAGG 961
            .|||:.||||:|||||:..:||.:|||...:.|..:..|.|..|:....    |.|        |
 Frog   925 CPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLIRY--------G 981

  Fly   962 YNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGV 1026
            |||.|.:.:.||:.|..:.|.|:||.|:||:|:|||.||...|:.|.....|.||.:||.|.||:
 Frog   982 YNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGL 1046

  Fly  1027 RFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCR 1091
            |.||||||.||.:||:.||.:||..:||.....||.|||.:              |.|.   .|.
 Frog  1047 RLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGKCGLL--------------GYSG---WCH 1094

  Fly  1092 LCGDNSSVSMIEIPFSFKYLVTELSSVNINARFKL 1126
            .|..:..||.:.||::.|.|..||.|:||..|.||
 Frog  1095 FCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKL 1129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 348/1177 (30%)
RNA_pol_B_RPB2 35..1125 CDD:238353 346/1173 (29%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/50 (22%)
polr3bNP_001121521.1 PRK08565 26..1130 CDD:236291 351/1191 (29%)
RNA_pol_B_RPB2 39..1128 CDD:238353 346/1173 (29%)
RNA_pol_Rpb2_4 540..601 CDD:282431 18/68 (26%)
RNA_pol_Rpb2_5 622..662 CDD:282432 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.