DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpI135 and polr2b

Sequence 1:NP_476708.1 Gene:RpI135 FlyBaseID:FBgn0003278 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001019632.2 Gene:polr2b ZFINID:ZDB-GENE-041008-1 Length:1174 Species:Danio rerio

Alignment Length:1237 Identity:339/1238 (27%)
Similarity:550/1238 (44%) Gaps:263/1238 (21%)


  Fly    40 VDSFDEML------------TVGLDNSAKHMIPNHWLSPAGE-----KISMKVESIWIAKPK--- 84
            :|||||.:            .:.|...|:|        .:||     :..:|.|.|:::||.   
Zfish    44 LDSFDEFIQMSVQRIVEDAPPIDLQAEAQH--------TSGEVEEPPRYLLKFEQIYLSKPTHWE 100

  Fly    85 ---VPQDVIDVRTREIYPTDSRQLHVSYSGMCSVRLGWSV--NGV-------QKTPINMDLGEVP 137
               .|..::        |.::|..:::||....|.:..::  :|.       |||.|    |::|
Zfish   101 RDGAPSPMM--------PNEARLRNLTYSAPLYVDITKTIIKDGEEQQQTQHQKTFI----GKIP 153

  Fly   138 IMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEK--IVRMLIMTRRNHPICVKRSSWKDR 200
            |||||..|.|...|..::.:..|...:.||.|:|.|:||  |.:..:.|...:....|.|.:...
Zfish   154 IMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYT 218

  Fly   201 GQNFSDLGMLVQTVREDESSLSNVVHYLNNGTAKFMFSH--VKRLSY----VPVCLILKCLMDYT 259
            |:..|   .|..:.|...:...:::.....|..|.....  |..|.|    ||:.::.:.|...:
Zfish   219 GECRS---CLENSSRPTSTIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVS 280

  Fly   260 DEEIYNRLVQGYESDQYYVSCVQAMLRE---VQNENVYTHAQCKSFIGNLFRARFPEVPEWQPDD 321
            |.:|...::..:: |...:..|:..|.|   :|.:||     ..:|||:  |...|.|.:.:...
Zfish   281 DRDILEHIIYDFD-DPEMMEMVKPSLDEAFVIQEQNV-----ALNFIGS--RGAKPGVTKERRIK 337

  Fly   322 DVTDFILRERVMIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPGHLYQ 382
            ...: :|::.|:.|:...:    .|...:.:|:.:|...|.|:.::::.|....:.:.|.|.|..
Zfish   338 YAKE-VLQKEVLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLA 401

  Fly   383 KYLSERVESWVSQVRRCLQKKL-TSPDALVTSAVMTQCMRQAGGVGRAIESFLATGNIA------ 440
            .......::.:.::|...||.: ...|..:..|:.|:.      :...::..|||||..      
Zfish   402 FLFRGMFKNLLKEIRIYAQKFIDRGKDFNLELAIKTRI------ISDGLKYSLATGNWGDVKKAH 460

  Fly   441 -SRTGLGLMQNSGLVIMAENINRMRY---MSHFRAIH----RGSYFTTMRTTEARQLLPDAWGFI 497
             :|.|           :::.:||:.:   :||.|.::    |..     :..:.|||....||.:
Zfish   461 QARAG-----------VSQVLNRLTFASTLSHLRRVNSPIGRDG-----KLAKPRQLHNTLWGMV 509

  Fly   498 CPVHTPDGTPCGLLNHLTLTCEISM--RPDP-----------KLVKAIPKHLIDMGMMPLSNRRY 549
            ||..||:|...||:.:|.|...||:  :|.|           .|.:..|..:.|...        
Zfish   510 CPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATK-------- 566

  Fly   550 LGEKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEI--GFIPFKKNGQFPGLYIAT 612
                   :|::|..:| ||: :.|::::.||      .|.:.|:|  ..:...::.:...:.|.|
Zfish   567 -------IFVNGCWVG-IHK-DPEQLMNTLR------KLRRQMDIIVSEVSMIRDIREREIRIYT 616

  Fly   613 GPARMMRPVW-----------------------NLKWKR------VEYIGTLEQLYMEIAIDAKE 648
            ...|:.||:.                       |..|:.      ||||.|||:..:.:|:...:
Zfish   617 DAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDD 681

  Fly   649 M------YPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQAAN 707
            :      |....||.|:..:..:...|::||.||:||||||.||..||||.||....|:..:...
Zfish   682 LQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDT 746

  Fly   708 KLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIY 772
            ..:.|..|..||......:.::..:...|.|:|||:.|||||:.||::|:|::|.:||| :.|::
Zfish   747 LAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGF-FRSVF 810

  Fly   773 KTKFLTLDKKSSY---------------FARHPHMPELIKHLDTDGLPHPGSKLSYGSPLYCYFD 822
            ...:...:.|..:               ..||    .:...||.|||..||.::|          
Zfish   811 YRSYKEQESKKGFDQEEIFEKPTRETCQGMRH----AIYDKLDDDGLIAPGVRVS---------- 861

  Fly   823 GE-VATYKVVKMDE-------------KEDC----------IVESIRQLGSFDLSPKKMVAITLR 863
            || |...|.|.:.|             |.||          ||:.:  :.:.:....|...|.:|
Zfish   862 GEDVIIGKTVTLPENDDELDSTNRRYTKRDCSTFLRTSETGIVDQV--MVTLNQEGYKFCKIRVR 924

  Fly   864 VPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKG 928
            ..|...||||||||.||||.|..:|..||:|||..|:.|||:.|||..|||||:..:||.:.||.
Zfish   925 SVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKV 989

  Fly   929 AAIHGNVYDATPFRFSEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQ 991
            :|..|.:.|||||     |.|::.  ...:|...||:..|.|.||:|..||::|:.||.|..:||
Zfish   990 SANKGEIGDATPF-----NDAVNVQKVSNLLSEYGYHLRGNEVLYNGFTGRKLTSQIFVGPTYYQ 1049

  Fly   992 RLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKT 1056
            ||:|||.||...|:.|.|:....||::||.|.||:||||||||..|:||||..|::|||..||..
Zfish  1050 RLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLKERLFEASDPY 1114

  Fly  1057 HTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNIN 1121
            ...||:.||.:.....|           :....||.|.:.:.:|::.:|::.|.|..||.|::|.
Zfish  1115 QVHVCNLCGLMAIANTR-----------THTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIA 1168

  Fly  1122 AR 1123
            .|
Zfish  1169 PR 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpI135NP_476708.1 RpoB 34..1128 CDD:223163 339/1238 (27%)
RNA_pol_B_RPB2 35..1125 CDD:238353 339/1238 (27%)
RNA_pol_Rpa2_4 564..614 CDD:284335 11/52 (21%)
polr2bNP_001019632.2 PRK08565 27..1172 CDD:236291 339/1238 (27%)
RNA_pol_B_RPB2 39..1172 CDD:238353 339/1238 (27%)
RNA_pol_Rpb2_4 567..629 CDD:282431 16/70 (23%)
RNA_pol_Rpb2_5 653..700 CDD:282432 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0085
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D42570at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.