DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2af38 and U2af1l4

Sequence 1:NP_001259814.1 Gene:U2af38 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_739566.1 Gene:U2af1l4 MGIID:2678374 Length:220 Species:Mus musculus

Alignment Length:220 Identity:167/221 (76%)
Similarity:187/221 (85%) Gaps:3/221 (1%)


  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65
            |||||||||||||||||||||||||||||||||||:|||||||||::|.|||.||||:|::||||
Mouse     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGS 65

  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130
            |  .:|||.|:|||||||||:||.|.::|||||||||||||||||||||||:|||.|.|||:|..
Mouse    66 H--CHVSDVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVA 128

  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRAR 195
            :||||||.|:.|::||||||||||:||||||||||||.||||||||:||||.|||.||.|..|.|
Mouse   129 ELNNRWFNGQAVHAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRNLRRQLYGRGPRHR 193

  Fly   196 SRSRS-PGRRRGSRSRSRSPGRRGG 219
            |..|| .|.|...|:|.|||..|.|
Mouse   194 SPPRSHTGHRPRERNRRRSPDHRHG 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..148 CDD:240982 75/105 (71%)
zf-CCCH 151..177 CDD:279036 24/26 (92%)
U2af1l4NP_739566.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..146 CDD:240982 75/105 (71%)
zf-CCCH 149..175 CDD:279036 24/26 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17905798
eggNOG 1 0.900 E1_KOG2202
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002828
OrthoInspector 1 1.000 T616265
orthoMCL 1 0.900 OOG5_127450
Panther 1 1.100 O PTHR12620
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.790

Return to query results.
Submit another query.