DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2af38 and U2af1

Sequence 1:NP_001259814.1 Gene:U2af38 FlyBaseID:FBgn0017457 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001157241.1 Gene:U2af1 MGIID:98884 Length:239 Species:Mus musculus

Alignment Length:253 Identity:188/254 (74%)
Similarity:205/254 (81%) Gaps:16/254 (6%)


  Fly     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGS 65
            |||||||||||||||||||||||||||||||||||:|||||||||:|:||:|.||||||::||||
Mouse     1 MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQNIYRNPQNSAQTADGS 65

  Fly    66 HLVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAEKAAN 130
            |..  |||.|||||||.|||:||.|.|:||||:||||||||||||||||||:|||.|.|||||..
Mouse    66 HCA--VSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVI 128

  Fly   131 DLNNRWFGGRPVYSELSPVTDFREACCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRRRAR 195
            |||||||.|:|:::|||||||||||||||||||||||.|||||||||||||||||.||.|||: :
Mouse   129 DLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRK-K 192

  Fly   196 SRSRSPGRRRGSRSRSRSPGRRGGGRGDGVGGGNYLNNERDNMRGNDRGNDRDRRKGG 253
            .||||..|.|.||||.|.   ||||.|.|.|||          |..||...|||.:.|
Mouse   193 HRSRSRSRERRSRSRDRG---RGGGGGGGGGGG----------RERDRRRSRDRERSG 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2af38NP_001259814.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..148 CDD:240982 78/105 (74%)
zf-CCCH 151..177 CDD:279036 25/26 (96%)
U2af1NP_001157241.1 zf-CCCH 13..39 CDD:279036 25/26 (96%)
RRM_U2AF35 43..146 CDD:240982 78/105 (74%)
zf-CCCH 149..175 CDD:279036 25/26 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17907208
eggNOG 1 0.900 E1_KOG2202
Hieranoid 1 1.000
Homologene 1 1.000 H14345
Inparanoid 1 1.050 375 1.000 Inparanoid score I2070
Isobase 1 0.950 0 Normalized mean entropy S1692
OMA 1 1.010
OrthoDB 1 1.010 D1340384at2759
OrthoFinder 1 1.000 FOG0002828
OrthoInspector 1 1.000 T616265
orthoMCL 1 0.900 OOG5_127450
Panther 1 1.100 LDO PTHR12620
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4380
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.