DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HSP90AA1 and Hsp83

Sequence 1:NP_001017963.2 Gene:HSP90AA1 HGNCID:5253 Length:854 Species:Homo sapiens
Sequence 2:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster

Alignment Length:720 Identity:571/721 (79%)
Similarity:646/721 (90%) Gaps:7/721 (1%)


Human   137 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHIN 201
            ||.||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||:|.
  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67

Human   202 LIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 266
            |||||...||||:||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132

Human   267 AEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKK 331
            |:||||.:|:||||||.||||||||||||.|..||:|||||::|::|||||:||||.:|||||.|
  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197

Human   332 HSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDK 396
            |||||||||.|.|||||:||||||||:  ::|:|..||:|.|: |:|:|||||.||:.:|||.|.
  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEAD--DEKKEGDEKKEMET-DEPKIEDVGEDEDADKKDKDA 259

Human   397 KKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRA 461
            ||||.|||||.:.|||||||||||||||||:.|||||||||||||||||||||||||||||||||
  Fly   260 KKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRA 324

Human   462 LLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQ 526
            |||:|||.|||||||:||:|||||||||||||||||:||||||||::||||||||||||||||||
  Fly   325 LLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQ 389

Human   527 QSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSA 591
            |:|:|||||||||||.:||..||.||||||||||:|||||:|||:||||.||.||::.||::|||
  Fly   390 QNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSA 454

Human   592 SGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLK 656
            |||:..||.||.:|||:||||:|:||||:||||:|||||||::..|.||:||.||||||.:|.||
  Fly   455 SGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLK 519

Human   657 EFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI 721
            |::||.|||||||||||||||.||||:||.|.|||:|||:||.||:.||||||||||||.|||||
  Fly   520 EYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCI 584

Human   722 VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVI 786
            |||.:||:||||||||||||||.:||||||.||.|||||||.|:|||||||:||||||:||||||
  Fly   585 VTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVI 649

Human   787 LLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDP-TADDTSAAVTEEMPPL-EGDDDTSR 849
            ||:||:||||||||:.||.||:|||||||||||||||:| |.||..:|  .:.|.| |..:|.|.
  Fly   650 LLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSA--GDAPSLVEDTEDASH 712

Human   850 MEEVD 854
            |||||
  Fly   713 MEEVD 717

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSP90AA1NP_001017963.2 PTZ00272 140..854 CDD:240341 568/716 (79%)
HATPase_c 162..313 CDD:214643 129/151 (85%)
HSP90 318..844 CDD:278607 406/528 (77%)
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 568/716 (79%)
HATPase_c 28..179 CDD:214643 129/151 (85%)
HSP90 184..706 CDD:278607 406/527 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70461816
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1149 1.000 Inparanoid score I208
Isobase 1 0.950 0 Normalized mean entropy S263
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T608727
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 O PTHR11528
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.