DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kis and chd3

Sequence 1:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:XP_009301392.1 Gene:chd3 ZFINID:ZDB-GENE-121031-4 Length:2101 Species:Danio rerio

Alignment Length:2445 Identity:624/2446 (26%)
Similarity:928/2446 (38%) Gaps:728/2446 (30%)


  Fly  1360 EDGAEQTGEGSEVED---------------NKPLVPKAGSADGEAETTSGGTGVD-GESPDYDDI 1408
            ::|.....||.:.::               |.|..|:..:|....:     .|.| ||:.|.|::
Zfish    11 DEGTAVNSEGGDFDEEEEDDGDLDENASDINSPAAPRETAARAAPD-----DGDDIGEASDRDNL 70

  Fly  1409 PVSKIPRGSNEDEKEAEAGDETVDSVPDSAGDPASTPSR--------RDRKRSTARSRRNANSEE 1465
              .|..||..: :||.:..|:      :..|..|....|        ||.:...|.:..:|.|:.
Zfish    71 --GKKKRGPKK-KKETKKKDK------EKEGKIAKARKRKKIESDIERDSEPDYAMNSDSAASDY 126

  Fly  1466 GGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDTLDRTPPPSPPPDSEMDSNKRRSSRNTQRKK 1530
            ||..:|.:.....|..|.::.:      .:.||.|.:.|..|     .||     ::|....|:.
Zfish   127 GGEKKKKKKHKDKKEKKTKKKK------KEDEDSTHEETTKP-----VEM-----KTSAQLAREW 175

  Fly  1531 YIDDVMLRFSDDENSLLV--------ASPVKKDKKPSANASNSNAGSDVEKTEPQSGAEGDAAQE 1587
            .::||...|::::...|.        ..|:...|.|..               |.|........:
Zfish   176 GLEDVDHTFTEEDYRTLTNYKAFSQFLRPMIAKKNPKI---------------PMSKMMTILGAK 225

  Fly  1588 VGEEKSNLPLDESSQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGDEDSMVVQLVLA 1652
            ..|..||.|...|:...|:::.:|.|....|:|  ||.|:....|.                   
Zfish   226 WREFSSNNPFKGSAAAVAAAAAAAAAAVAEQVS--AATASPEPPPQ------------------- 269

  Fly  1653 MRMGKRELILDKPKE-KAPEPKQDEEKSELDEATTDKPE------------GDEKFKTEGESKKD 1704
                ...|...|.|| |.|..|:..:...:.:....||:            |:::.|:....:.|
Zfish   270 ----PPPLRKAKTKEGKGPGYKKRSKSPRVSDKKKPKPKKMAPLRIKLGAIGNKRKKSSSSEEVD 330

  Fly  1705 LTDSEE--TKLESSAMEVDS------KEESEPDDSKKSDEDNKDKDKMEVDD------------- 1748
            ..|||:  :.:.||::..||      .:...|...||....::|.|..|.|.             
Zfish   331 EDDSEQENSSVHSSSVRSDSSGRVKKNKRGRPAKKKKKALGDEDGDGYETDHQDYCEVCQQGGEI 395

  Fly  1749 -------------------EVGKSDKESKPEEQSETVKTEENSKAIEEDKSSTVLTADHAKEPET 1794
                               |.....|.|.|..:.|.::.|                   |||   
Zfish   396 ILCDTCPRAYHLVCLEPELEKAPEGKWSCPHCEKEGIQWE-------------------AKE--- 438

  Fly  1795 VLEKMEVDEKANDDQSAVSKAEGSDEKSTD-----------------DSNPEEATTE-------- 1834
              |..|..|:..||...|....|.:|:..|                 ||.|......        
Zfish   439 --EDFEEFEEECDDVRDVESGLGGEEEEDDHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPE 501

  Fly  1835 -KNKESL-------EIEGEKERV---KEGEE----SVKKENDEKTEA----DMENKPEPVFIDVE 1880
             .|.|.|       .|:|..:::   :.||.    .|....|...:|    .|:.:||      .
Zfish   502 IPNGEWLCPRCTCPPIKGRVQKILHWRWGEPPPPVPVPPPPDAPPDAPPPPPMKGRPE------R 560

  Fly  1881 EYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDF------ 1939
            |:|||....||.||.|.||.:|   :...:...|.:|:|...         |||.:.|:      
Zfish   561 EFFVKLTAQSYWHCTWITELQL---EIFHSVMFRNYQRKTDM---------DEPPSLDYGSGGEE 613

  Fly  1940 ----TEVDRVLD-------------------MSVH---TDETSGETTKHYLVKWKSLPYEDCTWE 1978
                :|..|..|                   |.||   ......:...||||||:.|.|:.||||
Zfish   614 DSGKSEKRRAKDPQYAILEEKYYRYGIKPEWMMVHRIINHSVDKKGNYHYLVKWRDLTYDQCTWE 678

  Fly  1979 LEE-DVDNDKIEQ--YLRFNKI-----PQRSEWKSKKR---------PHPELWKKLEKTP--VYK 2024
            .:| |:....:.:  |.|..:.     |::.. |.::|         |..:...|.|:.|  |.:
Zfish   679 RDELDIPEFALHKTAYWRHREAVMKEDPEKPR-KMRRREENDEAPSTPVNDPTIKYEEQPEFVTE 742

  Fly  2025 GGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYG-IRGPFLVIAPLST 2088
            .|.:|..|||||||||:|||....:.|||||||||||||::.|::|:::.| .:|||||.|||||
Zfish   743 TGGTLHLYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLFKEGHTKGPFLVSAPLST 807

  Fly  2089 IPNWQREFEGWT-DMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKE--------PIKFNVLITT 2144
            |.||:||||.|. |..||.|.|...|:.:|::.|:.:...:.|..|:        ||||:||:|:
Zfish   808 IINWEREFEMWAPDFYVVTYTGDKDSRAIIRENEFTFDDTAVKGGKKAFKLRREAPIKFHVLLTS 872

  Fly  2145 FEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLL 2209
            :|::..|...||:.:|...|:||||||||...|....|....::|::||:|||||||:.|||.||
Zfish   873 YELVTIDQNVLKSIDWACLVVDEAHRLKNNQSKFFRRLNDYKIDHKLLLTGTPLQNNLEELFHLL 937

  Fly  2210 NFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNI 2274
            |||.|::|::.|.|:.||..:..|:::.||..||.|.||||||.||.|::..|.|.|:.|||:.:
Zfish   938 NFLTPNRFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPM 1002

  Fly  2275 QKKYYRGILEQNFSFL-KKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQHGEDP 2338
            |||||:.||.:||..| .||  ..|..:|:|.||:|:|||.||||...|        .::..:.|
Zfish  1003 QKKYYKFILTRNFEALNSKG--GGNQVSLLNIMMDLKKCCNHPYLFPVA--------AAEAPKTP 1057

  Fly  2339 ESYYK--NLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIR 2401
            ...|:  .|..::||::|:.|:|.|||..|||||:||||.:.||:|||:|....|.:|||||.|.
Zfish  1058 SGAYEGVGLTKASGKLMLLQKMLRKLKEQGHRVLVFSQMTKMLDLLEDFLDSEGYKYERIDGGIT 1122

  Fly  2402 GNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQR 2466
            |.||||||||::.||:.:|.|||.|:||||||||..||||||:||||||.||:||.:|.|||||.
Zfish  1123 GALRQEAIDRFNAPGAVQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQA 1187

  Fly  2467 KMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGA 2531
            ..|.|||.:.|.:.|..:...|..|:.|...|::.  ..|||.|:   :||:|::|:||.|....
Zfish  1188 NKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRP--GLGSKAGS---MSKQELDDILKFGTEEL 1247

  Fly  2532 VMDDDNAGDKFCEEDIDSI---------LKRRTQVITMES------EKGSTFSKASFAASGNRSD 2581
            ..|:..|||. .::|:..|         |..|:|..|.:|      |..|:|..|.:..   :.|
Zfish  1248 FKDEIEAGDN-KDDDMSVIHYDNAAIERLLDRSQDATDDSDMQNMNEYLSSFKVAQYTV---KED 1308

  Fly  2582 ITID-------------DPDFWTKWAKKVDIDPDACERDETEDLV--LSEPRR-RTQIK------ 2624
            ..|:             |||:|.|..:.       ....:.|||.  |.:.:| |.|:.      
Zfish  1309 DKIEEIEREIIKQEENVDPDYWEKLLRH-------HYEQQQEDLARNLGKGKRVRKQVNYNDAAQ 1366

  Fly  2625 --RYGHEDVMELNSEES-SNENSDEEGGIGLRSRRRKEKRDRAREKKGNDEYIPRERDALAALG- 2685
              :..|.|:.:..||.| .:|..||:  ...|...|::.|.:.|.:|  |:.:|   ..||.:| 
Zfish  1367 EDQEWHADISDNQSEYSVGSEEEDED--FDERPEGRRQSRRQLRNEK--DKPLP---PLLARVGG 1424

  Fly  2686 -LEEIQYGNWAKSECFKVEKGLLS--FGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVY 2747
             :|.:.:..       :..|..|:  ..||..::    ..|...|...|:..             
Zfish  1425 NIEVLGFNT-------RQRKAFLNAIMRWGMPAQ----DAFSSQWLVRDLRG------------- 1465

  Fly  2748 KGDEKIKT----FIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSAS 2808
            |.:::.|.    |:..|..|..||                                         
Zfish  1466 KSEKEFKAYVSLFMRHLCEPVADG----------------------------------------- 1489

  Fly  2809 GSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLG 2873
                                                               ::.:.:|..::.|.
Zfish  1490 ---------------------------------------------------SETFADGVPREGLC 1503

  Fly  2874 RHANKVLLRVRMLYYIQHEVIGDFVQQIKDNTPISELPIRPPPTPDQVPSSWWNPICCDKSLLVG 2938
            |  ..||.|:.::..::.:| .:| :.|.....:.||  :|..|.|...||              
Zfish  1504 R--QPVLTRIGVMSLVKKKV-QEF-EHINGKWSMPEL--KPEITVDSKKSS-------------- 1548

  Fly  2939 TYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKD 3003
                       ..:.|.:           ..|.....|..|.....||.......|       |.
Zfish  1549 -----------RASSPTI-----------KTDTPTPELSCNNTPCTSKPATPSPPD-------KT 1584

  Fly  3004 SDSTKLTGGDNKDSLLDPER--------PSSSGKSSSENASGGNDKTESENDATTVSESSYKSEV 3060
            ..|.|....|..:||.:|||        .:..|:|......|.....|.|.|..| ||.|..||.
Zfish  1585 EKSAKEAEKDEAESLTEPEREREKEKAKEAKEGESVESTEHGEATGNEGEKDPIT-SEKSQTSES 1648

  Fly  3061 LPGKGSDLDVSVAQQDALSATPELANTSDPKMNKNDAQVSASVSCDPADSSSPEAAGKAQGTGVQ 3125
            .....|| |....:...:|.:|........|..:.:.:.....:..|:||.|.:...|....|.:
Zfish  1649 PAAAASD-DSKTKENPDISQSPPKEKNEKEKQEEEEGKEKEPSTEKPSDSPSVKEESKEALKGDK 1712

  Fly  3126 TGDAGE--------------------LDIESEKKDNEKETKESTGDAPAVEAKKDSAAIAR---- 3166
            ...|||                    ||..||.|..|.:.:...|....|:.::....|:|    
Zfish  1713 KEKAGEEKEKTEASSPPSETTEKKDKLDQSSEVKKEEVKGERDAGKEVRVQREEVPKVISRPAER 1777

  Fly  3167 -------AEGDKTESCT---NNATTNISTTTTT-----------------------TTITNTT-- 3196
                   |:|..||..|   |.....||:....                       ..|.|..  
Zfish  1778 PRFMFNIADGGFTELHTLWQNEERAAISSGKINEIWHRRHDFWLLSGIVCHGYARWQDIQNDPQF 1842

  Fly  3197 TTTNNPSSKAANSNN----------------------------------TTD--H---------- 3215
            ...|.|....||..|                                  |.|  |          
Zfish  1843 AIINEPFKTQANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPTHPAMALNARFA 1907

  Fly  3216 -----ANSNSHLGLDEEESVAGSYPPTVAAVEDATTMWPSMQDLNTRLRRVITAYQRNYKKEELK 3275
                 |.|:.||   .:||:||:.|                  .|..|.:|:.      :.|||.
Zfish  1908 EVECLAESHQHL---SKESLAGNKP------------------ANAVLHKVLN------QLEELL 1945

  Fly  3276 LQQKA---KLQALVSSTPPLSVPTTPTLQSMQMQLQSGSGSGGSGIGSSAQHDASGRSLQALMQS 3337
            ...||   :|.|.:|..||:    |..||..:..:.|...:.|:...:........   .|..|:
Zfish  1946 SDMKADVTRLPATLSRVPPI----TARLQMSERSILSRLANKGNETHTPPPIPPGP---YATPQN 2003

  Fly  3338 QGASTSAAAAAAASSAGGSCSGSGQVGMGGAGVMPAMPTAADISLMLSILNTTDVNQLANLDINK 3402
            .|...:.|.:||.:.||.:.|              .||..:.||...|.|.|.:.:.|....:..
Zfish  2004 FGPPFTPAPSAALALAGANYS--------------QMPPGSFISEAPSCLKTKEHDVLQRQRVVD 2054

  Fly  3403 L-----AMYLVSMNNKMERQGKMELAAKERESQRLQLIPK 3437
            |     :...:....:|.:.....:..|.|.|..::.:|:
Zfish  2055 LWKDGKSEGTIGQELRMPKSTVHSIIVKYRLSNTVENLPR 2094

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 50/285 (18%)
HepA 1676..2527 CDD:223627 353/1011 (35%)
SDA1 <1693..>1854 CDD:283052 44/237 (19%)
CHROMO <1879..1919 CDD:237991 14/40 (35%)
Chromo 1941..1996 CDD:278797 22/80 (28%)
DEXDc 2048..2197 CDD:238005 72/159 (45%)
Helicase_C 2350..2464 CDD:278689 74/114 (65%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
chd3XP_009301392.1 CHDNT 181..233 CDD:285335 10/67 (15%)
PHD1_CHD_II 385..427 CDD:277006 4/42 (10%)
PHD2_CHD_II 470..512 CDD:277007 6/42 (14%)
Chromo 647..>681 CDD:278797 14/34 (41%)
SNF2_N 750..1046 CDD:278600 149/298 (50%)
DEXDc 767..925 CDD:238005 72/158 (46%)
Helicase_C 1070..1185 CDD:278689 74/115 (64%)
DUF1087 <1324..1368 CDD:283996 12/51 (24%)
DUF1086 1397..1536 CDD:283992 34/264 (13%)
CHDCT2 1809..1980 CDD:285336 36/202 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D54215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.