DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kis and CG4049

Sequence 1:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:NP_611885.3 Gene:CG4049 FlyBaseID:FBgn0034976 Length:1669 Species:Drosophila melanogaster

Alignment Length:1978 Identity:345/1979 (17%)
Similarity:576/1979 (29%) Gaps:827/1979 (42%)


  Fly  1558 PSANASNSNAGSDVEK--------------------------------TEPQSGAEGDAAQEV-- 1588
            |.||...||...||.:                                |:||...:....|:.  
  Fly     4 PEANMEESNPNYDVNQRLQKPEGWPHVNEFHPSMMYPDDPRRYFHNASTDPQHQPQQHPQQQPEQ 68

  Fly  1589 -GEEKSNLPL------DESSQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGDEDSMV 1646
             .|:....||      .:..|.:.........::..|:.......|....|..|.|:|..|.:|.
  Fly    69 HPEQHPQHPLHSQQQPQQHPQQQPQQHPQQQTQQPPQLQPQQHPQAQIQPPIPVPISTPMEGTME 133

  Fly  1647 VQLVLAMRMGKRELILDKPKEKAPEPKQDEEKSEL-----DEATTDKPEGDEKFKTEGESKKDLT 1706
            |.:              |..|..||..|..|...:     :.|....|.|.::..:.||.:    
  Fly   134 VPV--------------KMPEYCPETSQPVEPDRVINPLAEVAKNTVPYGHKRKNSAGEDQ---- 180

  Fly  1707 DSEETKLESSAMEVDSKEESEPDDSKKSDEDNKD-KDKMEVDDEVGKSDKESKPEEQSETVKTEE 1770
             :...||..:|.|           .||:....|: :|.|. ::.:..:...::.||.....:...
  Fly   181 -AANKKLSMAAAE-----------EKKNSHLRKNIRDVMN-ENNLDTTTLAAQREESERLARVAG 232

  Fly  1771 NSKAIEEDKSSTVLTADHAKEPETVLEKMEVDEKANDDQSAVSKAEGSDEKSTDDSNPEEATTEK 1835
            ..|::.|.:...|    |    :.:...:::||....:..||             :||.|     
  Fly   233 QQKSMREIQKQVV----H----KQIFRILQLDESEGIESCAV-------------ANPVE----- 271

  Fly  1836 NKESLEIEGEKERVKEGEESVKKEN-DEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTE 1899
                     ....|...||.:..:. |:...:.:..                         ...|
  Fly   272 ---------HHPPVDFPEEEIASDTFDDSNSSSLSG-------------------------GSIE 302

  Fly  1900 EELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSGETTKHYL 1964
            :.|.||.....:::............:....|:|..::|..|.|...:..:|.            
  Fly   303 DVLHKGASVQPSEVVTIDDSSDDDCILLSEEEEEEDDEDLNESDDATNSGMHV------------ 355

  Fly  1965 VKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSL 2029
                            :|:.|           :|..:........|||..:.|...|  :....:
  Fly   356 ----------------KDIYN-----------VPDENGQVVVNMAHPEGEETLYLAP--QIAKVI 391

  Fly  2030 RPYQLEGLNWL---------KFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAP 2085
            :|:|:.|:.:|         :::..:...||||..||||||:|.::|......:......|.:.|
  Fly   392 KPHQIGGVRFLYDNIIESTRRYNKSSGFGCILAHSMGLGKTLQVVSFCDIFLRHTSAKTVLCVMP 456

  Fly  2086 LSTIPNWQREFEGW-----TDMNV--------------------------VVYHGSVTSKQMIQD 2119
            ::|:.||..||..|     ||.||                          .|:.|.|    ::..
  Fly   457 INTLQNWLSEFNMWIPRYSTDSNVRPRNFDIFVLNDQQKTLTARAKVILNWVHDGGV----LLIG 517

  Fly  2120 YEYY-------YKT--ESGKVLKE---PIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLK 2172
            ||.:       .||  ..|.|::.   ....:::...:|.:|....|       |.:.||.||:|
  Fly   518 YELFRLLALKLVKTRKRKGSVIRPDGMDSSSDLMNLVYEALVKPGPD-------LVICDEGHRIK 575

  Fly  2173 NRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEF------GSL- 2230
            |.:..:...|:::....|::|:|.|||||:.|.:.:::|:.|:...::.||.:.|      |.. 
  Fly   576 NSHAGISLALKEIRTRRRIVLTGYPLQNNLLEYWCMVDFVRPNYLGTRTEFCNMFERPIQNGQCV 640

  Fly  2231 -RTEEEV-------NKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYRGIL---- 2283
             .|.:::       :.|.:||...:.||....::.:|..|.|.:|.|::|..|:|.|...:    
  Fly   641 DSTPDDIKLMRYRAHVLHSLLLGFVQRRSHTVLQLTLPQKYEYVILVKMTAFQRKLYDTFMTDVV 705

  Fly  2284 ----------------------EQNFSFLKK---------------------------------- 2292
                                  :..::||||                                  
  Fly   706 RTKAFPNPLKAFAVCCKIWNHPDVLYNFLKKCETDLDLEIDEEVTKGAATPIVEPSADSSLSLAS 770

  Fly  2293 -----------------------GTTSANIP---------------------------------- 2300
                                   ..|..|||                                  
  Fly   771 PLEKKINGSGDPINSIETFSKAENQTLFNIPASSDLNAKYLNKSPSFYDEKPEPLNYGSFGSEGK 835

  Fly  2301 --------------------------------------------NLMNTM-MELRKCCIHPYLLN 2320
                                                        |.:.|: ..::..|.:..|.|
  Fly   836 NNYWMDSSILPKPGCVEVIKQTDTNMSSNFESITGSSEIVDLDTNEIKTVETTIQAPCSNNQLDN 900

  Fly  2321 G---------------------AEEQIQYDFKS-QHGED---------PESYYKNLILSAGKMVL 2354
            |                     |.|..:...|| |..|:         .::|...||.::.||.:
  Fly   901 GCNAGKPSEWNAAGSKNSSGVAAAEPFKKLLKSKQRNEEFSCSWAVDLMKNYVSGLISNSPKMEI 965

  Fly  2355 IDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYP-----------FERIDGRIRGNLRQEA 2408
            ...:|.:....|.|:|:|||.:..|::||.||.....|           :.|:||......|:..
  Fly   966 FFCILKESLNLGDRILLFSQSLLTLNLLEVYLKSSYVPGSNQLWTKNSSYFRLDGSTSSQERERL 1030

  Fly  2409 IDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMVKIYR 2473
            ::.:: ..|:..:||:.|:||.||||||.|:.|||:|:.|||.:|.||..|.:|.||.|...:||
  Fly  1031 VNEFN-ANSNVKLFLISTRAGSLGINLTGANRVIIFDASWNPCHDTQAVYRIYRYGQTKPCFVYR 1094

  Fly  2474 LLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYGAVMDDDNA 2538
            ::.....|::::|:...|.|:...::...|.:.       .||.|:|.:|               
  Fly  1095 IVMDRCLEKKIYDRQIKKQGMSDRIVDECNPEA-------HLSMKDITNL--------------- 1137

  Fly  2539 GDKFCEEDIDSILKRRTQVITMESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDA 2603
                |:                                                     |.|.| 
  Fly  1138 ----CQ-----------------------------------------------------DYDSD- 1144

  Fly  2604 CERDETEDLVLSEPRRRTQIKRYGHEDVMELNSEESSNENSDEEGGIGLRSRRRKEKRDRAREKK 2668
                  ||.|                       ||.:....|                   ..|.
  Fly  1145 ------EDTV-----------------------EEVNKSTGD-------------------LSKP 1161

  Fly  2669 GNDEYIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFGWGRWSELLELGQFKRGWRDVDVE 2733
            |                                                                
  Fly  1162 G---------------------------------------------------------------- 1162

  Fly  2734 DCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTG 2798
                                        :|:|:|       ...|..|:.|..     |||.:.|
  Fly  1163 ----------------------------SPSEEG-------SKPGSANMSPNA-----SNKSNNG 1187

  Fly  2799 VSTP-----APGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKY 2858
            .:.|     .|.|.:|:       :|.....:.:|.....::...:...:..:|  .|...||.:
  Fly  1188 PTKPLDDQNTPKSPNGA-------SHSPIKTEKNDGQEHAVHVDGIINTILDMH--RHCVTKEPF 1243

  Fly  2859 --------DADAYLEGAYKKHLGRH---ANKVLLRVRMLY---YIQHEVIGD--------FVQQI 2901
                    ..|..|..|.|:...|.   ..|..:..|..|   .:.::::.:        ..|||
  Fly  1244 MHESLLVDQKDRKLSQAEKRQAHRSYELEKKAAVNQRFTYAPAKMNYKIVNNDGTVITKPMNQQI 1308

  Fly  2902 KDNTPISELPIRPPPTPDQ----VPSSWWN-----------PI-------CCDKSLL-------V 2937
            |.||..|        |..:    :|:..|.           |:       ..||:.:       |
  Fly  1309 KTNTSSS--------TGGRSTRWIPADVWQRQGMTAQEMTLPLDVVIPTNSADKANIILKAGQRV 1365

  Fly  2938 GTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTK 3002
            ...|....:|.|:               .:|..:|:.:....|.:..:|.|..|..||..|.|||
  Fly  1366 MVLKSAKGIYMQL---------------DSGKIIAIRTTAKTEPEKTNKDDVIDITDDGDTDTTK 1415

  Fly  3003 ----DSDSTKLTGGD------NKDS----LLDPERPSSSGKSSSENASGGNDKTESEND-ATTVS 3052
                :.|...||..|      ||:|    ...||.|:...| |:||......:|:.... |||.:
  Fly  1416 PQSPEEDVKDLTADDEPRVVKNKESNPATTSRPEMPAKDRK-STENVQHFKSQTQPNTTLATTTN 1479

  Fly  3053 ESSYKSEVLPGKGSDLDVSVAQQD--------------------ALSATPELANTSDPKMNKNDA 3097
            :..     ||   |||..|..||.                    |......|....:...|.|..
  Fly  1480 QHQ-----LP---SDLTYSQPQQSHQQPQQQASQQQPAQQPPPPAYKHQNHLPAAGEGYSNANSI 1536

  Fly  3098 QVSASVSCDPADSSSPEAAGKAQGTGVQ 3125
            |.:..:...|...:|.||...|..:..|
  Fly  1537 QPNVPLPPHPGAPNSSEAPPPADSSYFQ 1564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 49/275 (18%)
HepA 1676..2527 CDD:223627 210/1129 (19%)
SDA1 <1693..>1854 CDD:283052 26/162 (16%)
CHROMO <1879..1919 CDD:237991 4/40 (10%)
Chromo 1941..1996 CDD:278797 5/55 (9%)
DEXDc 2048..2197 CDD:238005 47/192 (24%)
Helicase_C 2350..2464 CDD:278689 44/125 (35%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
CG4049NP_611885.3 SNF2_N 394..730 CDD:278600 77/347 (22%)
DEXDc 420..598 CDD:238005 46/189 (24%)
HELICc 958..1093 CDD:238034 47/136 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138587616
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.