DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kis and Iswi

Sequence 1:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:NP_523719.1 Gene:Iswi FlyBaseID:FBgn0011604 Length:1027 Species:Drosophila melanogaster

Alignment Length:1066 Identity:326/1067 (31%)
Similarity:487/1067 (46%) Gaps:244/1067 (23%)


  Fly  1808 DQSAVSKAEGSDEKSTDDSNPEEATTEKNKESLEIEGEKERVKEGEESVKKENDEKTEADMENKP 1872
            |.:||...|.:..::|.|:    ||:.        .||||          .|.|.|.|||     
  Fly     5 DTAAVEATEENSNETTSDA----ATSS--------SGEKE----------AEFDNKIEAD----- 42

  Fly  1873 EPVFIDVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFNQ 1937
                        :.|.|.:|..:.......:....:...|.:...:|          |:|:    
  Fly    43 ------------RSRRFDFLLKQTEIFTHFMTNSAKSPTKPKGRPKK----------IKDK---- 81

  Fly  1938 DFTEVDRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELEED----VDNDKIEQYLRFNKIP 1998
                 |:..|::.|....:                     |.|||    .::...::..||    
  Fly    82 -----DKEKDVADHRHRKT---------------------EQEEDEELLAEDSATKEIFRF---- 116

  Fly  1999 QRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQ 2063
                               :.:|.|.....:|.||:.||||:...:.|..|.|||||||||||:|
  Fly   117 -------------------DASPAYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQ 162

  Fly  2064 SLTFVHSVYEY-GIRGPFLVIAPLSTIPNWQREFEGW-TDMNVVVYHGSV-TSKQMIQDYEYYYK 2125
            :::.:..:..: ...||.:||.|.||:.||..||:.| ..:..|...|.. |....|:|      
  Fly   163 TISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRD------ 221

  Fly  2126 TESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHR 2190
                 ||. |.:::|.:|::||.:.:....|.||||..|||||||:||...||.|.||:....:|
  Fly   222 -----VLM-PGEWDVCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANR 280

  Fly  2191 VLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGS---LRTEEEVNKLQALLKPMMLRRLK 2252
            :|::|||||||:.||::|||||.|..|:|.|:|...|.:   |..:..:.:|.|:|||.:|||||
  Fly   281 LLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLK 345

  Fly  2253 DDVEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPY 2317
            .:|||.|.||:|..|.|.|:.:|:.:|..:|.::...: .|........|.|.:|:||||..|||
  Fly   346 AEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVV-NGAGKVEKMRLQNILMQLRKCTNHPY 409

  Fly  2318 LLNGAEEQIQYDFKSQHGEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDIL 2382
            |.:|||....|...:           :|:.::|||.::|||||||:..|.||||||||.|.||||
  Fly   410 LFDGAEPGPPYTTDT-----------HLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDIL 463

  Fly  2383 EDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSD 2447
            |||..:|.|.:.|:||:.....|...|..::...|.:|:|:|.|:||||||||..||.|||||||
  Fly   464 EDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSD 528

  Fly  2448 WNPQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSK--DG 2510
            ||||.||||..|.|||||:|.|:::||:..:|.|.::.::|.:||.|||.|:     ||.:  |.
  Fly   529 WNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVI-----QGGRLVDN 588

  Fly  2511 NNKQLSKKEIEDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKR-----RTQVITMESEKGS---T 2567
            .:.||:|.|:.::::.||.......:.   ...:||||.||:|     ..|...::|...|   |
  Fly   589 RSNQLNKDEMLNIIRFGANQVFSSKET---DITDEDIDVILERGEAKTAEQKAALDSLGESSLRT 650

  Fly  2568 FSKASFAASGNRSDITIDDPDFWTKWAKKVD-------IDPDACERDET--------EDLVLSEP 2617
            |:..:...:|..|....:..|    |.:|..       |:|...||...        |.|.:|||
  Fly   651 FTMDTNGEAGTSSVYQFEGED----WREKQKLNALGNWIEPPKRERKANYAVDAYFREALRVSEP 711

  Fly  2618 RRR----------TQIKRYGHEDVMELNSEESSNENSDEEGGIGLRSRRRKEKRDRAREKKGNDE 2672
            :..          .|..::....:.||..:|.......    :|.:..:..|....|.:.:..::
  Fly   712 KAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKT----VGYKVPKNTELGSDATKVQREEQ 772

  Fly  2673 YIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFGWGRWSELLELGQF-----KRGWRDVD- 2731
               |:.|....|..||||           .::.|||.|:..|:: .:..||     |.|..|:| 
  Fly   773 ---RKIDEAEPLTEEEIQ-----------EKENLLSQGFTAWTK-RDFNQFIKANEKYGRDDIDN 822

  Fly  2732 --------------------------VEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQ 2770
                                      ::|..||:    .|:.:|:.||:..:  .|....|   |
  Fly   823 IAKDVEGKTPEEVIEYNAVFWERCTELQDIERIM----GQIERGEGKIQRRL--SIKKALD---Q 878

  Fly  2771 KISRDHSGLHNL-VPRGRNGGKSNKE 2795
            |:||..:..|.| :..|.|.||:..|
  Fly   879 KMSRYRAPFHQLRLQYGNNKGKNYTE 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191
HepA 1676..2527 CDD:223627 253/731 (35%)
SDA1 <1693..>1854 CDD:283052 12/46 (26%)
CHROMO <1879..1919 CDD:237991 4/40 (10%)
Chromo 1941..1996 CDD:278797 9/59 (15%)
DEXDc 2048..2197 CDD:238005 60/152 (39%)
Helicase_C 2350..2464 CDD:278689 68/114 (60%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
IswiNP_523719.1 DBINO <30..67 CDD:290603 12/64 (19%)
SNF2_N 131..411 CDD:278600 121/293 (41%)
DEXDc 148..287 CDD:238005 60/151 (40%)
HELICc 422..553 CDD:238034 73/142 (51%)
HAND 697..796 CDD:286232 22/117 (19%)
SANT 797..838 CDD:197842 7/42 (17%)
SANT 799..838 CDD:238096 7/40 (18%)
SLIDE 853..965 CDD:286233 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138569053
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.