DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kis and Chd1

Sequence 1:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster
Sequence 2:NP_001245851.1 Gene:Chd1 FlyBaseID:FBgn0250786 Length:1900 Species:Drosophila melanogaster

Alignment Length:2269 Identity:554/2270 (24%)
Similarity:861/2270 (38%) Gaps:729/2270 (32%)


  Fly  1325 PKAKKPKDPNDPNSTETPAAVKKRAGASKRRKQYGEDGAEQTGEGSEVEDNKPLVPKAGSADGEA 1389
            |...|..||......|:..::             |.|..:.|.|.:...|:      :||..|  
  Fly     9 PDKSKQFDPGCRALNESANSI-------------GSDEQDDTREEANGTDH------SGSGSG-- 52

  Fly  1390 ETTSGGTGVDGESPDYDDIPVSKIPRGSNEDEKEAEAGDETVDSVPDSAGDPASTPSRRDRKRST 1454
               ||.:|.|.:|                             ||...::.|..|:|...|:..|.
  Fly    53 ---SGSSGSDSDS-----------------------------DSSSGNSSDGRSSPEPEDKSLSV 85

  Fly  1455 ARSRRNANSEEGGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDTLDRTPPPSPPPDSEMDSNK 1519
            |.....|.:.:..|  |..|.                 ..|.||.:.|.:.......|:|..|::
  Fly    86 AGFPPTAAAAQADS--KTNGF-----------------TDDQEDSSSDGSSGSDSDSDAEGPSDQ 131

  Fly  1520 RRSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSANASNSNAGSDVEKTEPQSGAEGDA 1584
            |..|.|                                      |:|..|.:.|  |:...|.|.
  Fly   132 RNQSIN--------------------------------------NANTSSSLPK--PEQNEEEDN 156

  Fly  1585 AQEVGEEKSNLPLDESSQLEASSSTSAVAEKERQISTDAANAAMSSKPNYVYINTGDEDSMVVQL 1649
            ..|.|:::   |..::|..|:|.|::.|:      .|.:::::...:.:|....|          
  Fly   157 ETEAGQQQ---PASDASADESSDSSANVS------PTSSSSSSEEEEEDYRPKRT---------- 202

  Fly  1650 VLAMRMGKRELILDKPKEKAPEPKQDEEKSELDEATTDKPEGDEKFKTEGESKKDLTDSEETKLE 1714
                |..::.....:..:|||.||..::..:.|| :.:..:.|::..|..:.|...|.|     .
  Fly   203 ----RQARKPPTAAEKSKKAPAPKNKKKTWDSDE-SDESEDSDDEVSTAQKRKPAATTS-----R 257

  Fly  1715 SSAMEVDSKEESEPDDSKKSDEDNKDKDKMEVDDEVGKSDKESKPEEQSETVKTEENSKAIEEDK 1779
            |...:...:...:|..|:.||:|:..|...........|.||:..:|.:::    |:....|.|:
  Fly   258 SKLAQQQQRRRVKPFSSEDSDDDDASKRCATRRKGAAVSYKEASEDEATDS----EDLLEFEYDE 318

  Fly  1780 SSTVLTADHAKEPETVLEKMEVDEK----------ANDDQSAVSKAE--------GSDEKSTDDS 1826
            |....||..|:|.    ||.|..|:          ...:|:.:...|        |.|||.|.|:
  Fly   319 SQAATTAATAEEE----EKCETIERILAQRAGKRGCTGNQTTIYAIEENGFDPHAGFDEKQTPDA 379

  Fly  1827 NPEEATTEKNKESLEIEGEKERVKEGEESVKKENDEKTEADMENKPEPVFIDVEEYFVKYRNFSY 1891
                                                :|||              ::.:|::.:||
  Fly   380 ------------------------------------ETEA--------------QFLIKWKGWSY 394

  Fly  1892 LHCEWRTEEELLKGDRRVAAKIRRFQQKQSQQ-----------LNIFE---NIEDEPFNQDFTEV 1942
            :|..|.:|..|.....:...|:..|.:|:.:|           ::.||   .::.| ..:.:..|
  Fly   395 IHNTWESEATLRDMKAKGMKKLDNFIKKEKEQAYWRRYAGPEDIDYFECQLELQHE-LLKSYNNV 458

  Fly  1943 DRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLR----FNK------I 1997
            ||::......|    :.|:.||.||:||||.:.|||....|    :.::.|    ||.      .
  Fly   459 DRIIAKGSKPD----DGTEEYLCKWQSLPYAESTWEDAALV----LRKWQRCAEQFNDRESSKCT 515

  Fly  1998 PQRSEWKSKKRPHPELWKKLEKTPVY-KGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKT 2061
            |.|.....|.||.   :.:::..|.: ..|.:||.||::|||||..||...::.|||||||||||
  Fly   516 PSRHCRVIKYRPK---FSRIKNQPEFLSSGLTLRDYQMDGLNWLLHSWCKENSVILADEMGLGKT 577

  Fly  2062 IQSLTFVHSVYE-YGIRGPFLVIAPLSTIPNWQREFEGWT-DMNVVVYHGSVTSKQMIQDYEYYY 2124
            ||::.|::|::: :.:.||||.:.||||:..|||||:.|. |||||.|.|.:.|:::||.||:.:
  Fly   578 IQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGDIKSRELIQQYEWQF 642

  Fly  2125 KTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEH 2189
              ||.|.|    |||.::||:|:::.|...|....|...::||||||||.:..|.:.|::.:..|
  Fly   643 --ESSKRL----KFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNH 701

  Fly  2190 RVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDD 2254
            |:|::||||||::.||::||:|:.|.:|.:.|.|..:.|:.. ::...:|...|:|.:|||:|.|
  Fly   702 RLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAE-DKGYTRLHQQLEPYILRRVKKD 765

  Fly  2255 VEKSLAPKEETIIEVELTNIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLL 2319
            |||||..|.|.|:.||:|::||:||:.||.:||..|:||...:. ...:|.::||:|||.|..|:
  Fly   766 VEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGST-STFLNIVIELKKCCNHAALI 829

  Fly  2320 NGAEEQIQYDFKSQHGEDPESYYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILED 2384
            ..:|.::.       |...:...:.|:..:||:||:||||.:||..||||||||||||.||:|.|
  Fly   830 RPSEFELM-------GLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLAD 887

  Fly  2385 YLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWN 2449
            ||..|.:||:|:||.|:|.:|::|:|.::..||..|.|||.|:||||||||..||||||:|||||
  Fly   888 YLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWN 952

  Fly  2450 PQNDLQAQARCHRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQG----SKDG 2510
            ||||||||||.|||||:..|.||||:...:.|.::.::|..|:.||..|:|.|:|.|    .|.|
  Fly   953 PQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSG 1017

  Fly  2511 -----NNKQLSKKEIEDLLKKGAYGAVMDD-DNAGDKFCEEDIDSILKRR--------------- 2554
                 |:...:|.::..:||.||.....|: ::..|..|  |||.||:|.               
  Fly  1018 NGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHDDDLVC--DIDEILRRAETRNEDPEMPADDLL 1080

  Fly  2555 -----TQVITMESEKGSTFSKASFAASGNRSDITIDDPDFWTKWAKKVDIDPDACER-------- 2606
                 ..:...|.|...:.||....|:|..     ||...|.      ||.|:...:        
  Fly  1081 SAFKVASIAAFEEEPSDSVSKQDQNAAGEE-----DDSKDWD------DIIPEGFRKAIDDQERA 1134

  Fly  2607 DETEDLVLSEPRRRT-----QIKRYGHEDVMELNSEESSNENSDEE---GGIGLRSRRRKEKRDR 2663
            .|.|||.| .|||:|     :.||...:........:.|..:||.|   .|.|...|.||..|..
  Fly  1135 KEMEDLYL-PPRRKTAANQNEGKRGAGKGGKGKQQADDSGGDSDYELGSDGSGDDGRPRKRGRPT 1198

  Fly  2664 AREKKGNDEYIPRERDALAALGLEEIQYGNWAKSECFKVEKGLLSFGWGRWSELLELGQFKRGWR 2728
            .:||      |....||                                      ||.:|.|.::
  Fly  1199 MKEK------ITGFTDA--------------------------------------ELRRFIRSYK 1219

  Fly  2729 DVDVEDCARIILLYCLQVYKGDEKIKTFIWDLITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSN 2793
            .....       |:.::....|.::           ::..:.::.|....||:...:..:..|..
  Fly  1220 KFPAP-------LHRMEAIACDAEL-----------QEKPLAELKRLGEMLHDRCVQFLHEHKEE 1266

  Fly  2794 KESTGVSTPAPGSASGSNSGNTTPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKY 2858
            :..|..:...||            |.:..|........||::.:|                    
  Fly  1267 ESKTAATDETPG------------AKQRRARATFSVKLGGVSFNA-------------------- 1299

  Fly  2859 DADAYLEGAYKKHLGRHANKVLLRVRMLYYIQHEVIGDFVQQ-------IKDNTPISELPIRPPP 2916
                               |.||.........:|::....::       ||...|:.::.     
  Fly  1300 -------------------KKLLACEQELQPLNEIMPSMPEERQQWSFNIKTRAPVFDVD----- 1340

  Fly  2917 TPDQVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHV------------------- 2962
                     |. |..|..||.|.|::|...:.||:.||.|.....:                   
  Fly  1341 ---------WG-IEEDTKLLCGIYQYGIGSWEQMKLDPTLKLTDKILLNDTRKPQAKQLQTRAEY 1395

  Fly  2963 ----------------------GAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTTTKDSD 3005
                                  .|..|.|..|.:....:..||  |..||::...|..|..:.|:
  Fly  1396 LLKIIKKNVELTKGGQRRQRRPRASRANDAKAASQSASSTIDA--KPHDGEDAAGDARTVAESSN 1458

  Fly  3006 S--------------TKLTGGDNKDSLLDPERPSSSGKSSSENASGGNDKTESENDATTVSE--- 3053
            |              |:..|        ||.:.:...|:.|:..|..::........|..:|   
  Fly  1459 SQVDPSTASPHNAPATEQHG--------DPAKKAKKSKARSKKTSASDNNGNKPMHFTANNEPRA 1515

  Fly  3054 ------------SSYKSEVLPGKGS-----DLDVSVAQQDALSATPE---------------LAN 3086
                        :..|.::.|.|.:     ..|||::.||.|..|.:               .|.
  Fly  1516 LEVLGDLDPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCLLQIGKQIDVCLNPYAE 1580

  Fly  3087 TSDPKMNKN------------------------------DAQVSASVSCDPADSSSPEAAGKAQG 3121
            |...:...|                              |.:....   |...|.||   .|::.
  Fly  1581 TEKKEWRSNLWYFVSKFTELDAKRLFKIYKHALKQKAGGDGEAKGK---DKGSSGSP---AKSKP 1639

  Fly  3122 TGVQTGD-AGELDIESEKKDNEKETKESTGDA---------------PAVEAKKD------SAAI 3164
            .||.|.: ..|.|....||..:.:.||.:|.|               |.::.|:|      |:.:
  Fly  1640 NGVTTEEKEKERDRSGGKKKKKDKDKERSGQARYPETGIPTSGRYADPPLKRKRDENDADASSGL 1704

  Fly  3165 ARAE----GDKTESCTNNATTNISTTTTTTTITNTTTTTNNPSSKAANSNNTTD---HANSNSHL 3222
            |.|.    ||..:|.                           |.|..|.:...|   |.....:.
  Fly  1705 AGAPGGGIGDNLKSM---------------------------SFKRLNMDRHEDRKKHHRGPDYY 1742

  Fly  3223 GLDEEESVAGSY--------------------------PPTVAAVEDATTMWPSMQDLNTRLRRV 3261
            |.......:|||                          ||..:...      |.|:...:|.|  
  Fly  1743 GGSGPPMGSGSYEGGSNSRRQGPTSPSTPRTGRGGYDPPPAPSGYT------PEMERWQSRDR-- 1799

  Fly  3262 ITAYQRNYKKEELKLQQKAKLQALVSSTPPLSVPTTPTLQSMQMQLQSGSGSGGSGIGS 3320
               |.::||::.                                  ..|.|..|.|.||
  Fly  1800 ---YSQDYKRDR----------------------------------YDGYGRSGGGQGS 1821

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 47/232 (20%)
HepA 1676..2527 CDD:223627 318/905 (35%)
SDA1 <1693..>1854 CDD:283052 35/179 (20%)
CHROMO <1879..1919 CDD:237991 9/40 (23%)
Chromo 1941..1996 CDD:278797 20/59 (34%)
DEXDc 2048..2197 CDD:238005 69/151 (46%)
Helicase_C 2350..2464 CDD:278689 78/114 (68%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
Chd1NP_001245851.1 CHROMO 374..422 CDD:237991 15/98 (15%)
Chromo 458..509 CDD:278797 20/59 (34%)
SNF2_N 548..829 CDD:278600 130/289 (45%)
DEXDc 564..709 CDD:238005 69/151 (46%)
Helicase_C 852..967 CDD:278689 78/115 (68%)
DUF4208 1521..1610 CDD:290618 13/89 (15%)
DUF3824 1795..>1894 CDD:289625 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138587940
eggNOG 1 0.900 E2759_KOG0384
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45623
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.