DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and AT5G57210

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_200531.1 Gene:AT5G57210 / 835827 AraportID:AT5G57210 Length:737 Species:Arabidopsis thaliana


Alignment Length:333 Identity:61/333 - (18%)
Similarity:101/333 - (30%) Gaps:145/333 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 LLQGILMTYVMYNFDLGYVQGMSDLLAPIL-----------EIQVNEVDTFWCFVGFMELVFT-- 512
            :|:.||:.:.:.:.::||.|||.:||||:|           |::.|..|.|...  |.||.|.  
plant   140 MLRRILLLWCLKHPEIGYRQGMHELLAPLLYVLQVDVQYLTEVRSNYEDQFVDL--FDELAFQER 202

  Fly   513 -----NFDI-----------------------------DQAGMKTQFA----------------- 526
                 :|||                             |:...:||.|                 
plant   203 DSGAYDFDIKKVLDDSMEDEEEDGPPSGSTKKKKPKSFDELDTETQTAVLLSDAYGGEGELGIVL 267

  Fly   527 ----------------------------------------------------QIRRLIEFANAPL 539
                                                                .:..|:...:|.|
plant   268 SDKFMEHDAYTMFDALMYGGSSLGSVSVANFFIYSAPNDSITGLPPVIEASGALYHLLSLVDASL 332

  Fly   540 FNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSVAILDQETRVII 604
            .:::.....:..||..|||.|.:.||....::|.:|:            .:||....:.|..|..
plant   333 HSHLVELGVEPQYFALRWLRVLFGREFPLSNLLIVWD------------EIFSADNSEVERGVEA 385

  Fly   605 DSQYEFTEILKHVNELSGNIDVQKTLQVAEGIYLQ--LKGSETLPNDIRSIIGEPLLPAAAGEEI 667
            |...||..:......|...:.|...|      ||:  |..:|...:.::.::..|       |:|
plant   386 DLGCEFRILSSPRGALVAGMAVSMIL------YLRSSLLATENATSSLKKLLNFP-------EDI 437

  Fly   668 DGGMVDEE 675
            |...|.|:
plant   438 DLSKVIEK 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 43/252 (17%)
AT5G57210NP_200531.1 TBC <115..374 CDD:214540 42/247 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.