DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and AT3G55020

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001319752.1 Gene:AT3G55020 / 824668 AraportID:AT3G55020 Length:819 Species:Arabidopsis thaliana


Alignment Length:499 Identity:101/499 - (20%)
Similarity:182/499 - (36%) Gaps:141/499 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FQHGNADLFVRSMRDQHLIENAETSRSGGEVYAILTTENQKLKKTFAELDIGQIKASQLPRESWL 242
            |:| ..|.:...:|.||:    :..|...::|.....|......:|.|   ..:::::||.....
plant    24 FEH-KRDAYGFPVRPQHV----QRYREYADIYKEEEEERSDRWSSFLE---DHVESTELPTNGSS 80

  Fly   243 PNKLAGILGNIPDYVQPPFQRSPKSR-------PGVLISGDR---QTSPDN-------------- 283
            .|            :..||..|.|.:       ||..:..|:   ..:|||              
plant    81 EN------------IHAPFSESEKEKEKELNKGPGEDLHTDKLGSDVTPDNASEEEGHPDAEKNV 133

  Fly   284 --YQI----------------------------------IGLSGSTNSACSSNGQSRGGSAEK-- 310
              .|:                                  :.:|.|.:.|.||.|.|...|.::  
plant   134 HRVQLWTEIRPSLRSIEDLMSIRVKKKGDLSKSEQEAPKVKISPSFDDAKSSKGASDIDSEDEFY 198

  Fly   311 SPADSELETLNAQDEKIVNNLPDRQRVERGHPLTETQWLEFQTPDGRISDSARIKELIFRGGVVQ 375
            ....|:::..::.|...|:.:|   ......||:...|.|             ..|::.||||..
plant   199 DVERSDVQDGSSSDGTGVSGIP---VAADASPLSTCPWKE-------------ELEVLIRGGVPM 247

  Fly   376 SLRPEVWKFLL--------NYY---LWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEANFCG 429
            :||.|:|:..:        :||   |.:|..|..||:...:.::......:.:|:.         
plant   248 ALRGELWQAFVGVRKRRCKDYYQNLLAADGSVNTIEQEDMQHVDDKGSSTESIAVV--------- 303

  Fly   430 YRERKCQIEKDVKRTDRSLQFFAGE---DNPNLTLLQGILMTYVMYNFDLGYVQGMSDLLAPILE 491
             .:.|.|||||:.||      |.|.   |:.....|:.:|..|..:|..:||.|.| :..|.:|.
plant   304 -EKWKGQIEKDLPRT------FPGHPALDDDGRNALRRLLTAYARHNPSVGYCQAM-NFFAALLL 360

  Fly   492 IQVNEVDTFWCFVGFMELVFTNFDIDQAGMKTQFAQ--IRRLIEFANAPLFNYMRSHDSDNMYFC 554
            :.:.|.:.||..:|.::..|..:..::. :::|..|  :..|:......|.:::........:..
plant   361 LLMPEENAFWALIGLIDDYFNGYYSEEM-IESQVDQLVLEELVRERFPKLVHHLDYLGVQVAWVT 424

  Fly   555 FRWLLVWYKRELNSEDVLKLWECL---WTRLPCPNFHLLFSVAI 595
            ..|.|..:...|..|.||::|:.|   .||:      :||..|:
plant   425 GPWFLSIFMNMLPWESVLRVWDVLLFEGTRV------MLFRTAL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931 3/12 (25%)
TBC 369..598 CDD:214540 59/246 (24%)
AT3G55020NP_001319752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.