DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and AT3G07890

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_001078123.1 Gene:AT3G07890 / 819980 AraportID:AT3G07890 Length:400 Species:Arabidopsis thaliana


Alignment Length:366 Identity:75/366 - (20%)
Similarity:139/366 - (37%) Gaps:97/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 ISDSARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSI---EYYNMKAQWLAM 419
            ::::..:|.|| |.|:...|||:|| |.|:            ...|:||.   .||:...:.:..
plant   103 LTNAITLKRLI-RKGIPPVLRPKVW-FSLS------------GAAKKKSTVPESYYSDLTKAVEG 153

  Fly   420 TTTQEANFCGYRERKCQIEKDVKRTDRSLQFFAGE---DNP-NLTLLQGILMTYVMYNFDLGYVQ 480
            ..|....         ||:.|:.||      |.|.   |.| ....|:.:|:.|...:.|:||.|
plant   154 MVTPATR---------QIDHDLPRT------FPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQ 203

  Fly   481 GMSDLLAPILEIQVNEVDTFWCFVGFME--LVFTNFDIDQAGMKTQFAQIRRLIEFANAPLFNYM 543
            |::.:.|.:|.:...|.|.||.....:|  ||...:..:.:|...:....:.|:....:.:..::
plant   204 GLNYVAALLLLVMKTEEDAFWMLAVLLENVLVRDCYTTNLSGCHVEQRVFKDLLAQKCSRIATHL 268

  Fly   544 RSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQY 608
            .....|.......|.|..:.:.|.||..|::|:.|:                            |
plant   269 EDMGFDVSLVATEWFLCLFSKSLPSETTLRVWDVLF----------------------------Y 305

  Fly   609 EFTEILKH----VNELSGNIDVQKTLQVAEGIYLQLKGSETL--PNDIRSIIGEPLLPAAAGEEI 667
            |..::|.|    :.::..| ::..|.||.:.|.:..|.|..|  |:::.::..|.:         
plant   306 EGAKVLFHAALAIFKMKEN-ELLMTHQVGDVINILQKTSHQLFDPDELLTVAFEKI--------- 360

  Fly   668 DGGMVDEEPTYSDDGFDELVKELTPEEKVRQQALLEEACER 708
             |.|.              ...::.:.|.::.|::.|..:|
plant   361 -GSMT--------------TNTISKQRKKQEPAVMAELDQR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 52/237 (22%)
AT3G07890NP_001078123.1 TBC 113..327 CDD:214540 58/271 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.