DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbc1d15-17 and letm1

DIOPT Version :9

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:XP_012821404.1 Gene:letm1 / 780254 XenbaseID:XB-GENE-954420 Length:766 Species:Xenopus tropicalis


Alignment Length:118 Identity:25/118 - (21%)
Similarity:48/118 - (40%) Gaps:38/118 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 LDQETRVIIDSQYEFTEILKHVNELSGNI-----DVQKTLQVAEGIYLQLKGSETLPNDIRSIIG 655
            |.::.:::...:.|.:|:...|.|.|.::     ::.||.|  |.:..:.|.|:.|...:..:||
 Frog   573 LKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQ--EKVLQETKASKILTKRVNRMIG 635

  Fly   656 EPLLPAAAGEEIDGGMVDEEPTYSDDGFDELVKELTPEEKVRQQALLEEACER 708
            :                          .|:::.||..||||     |:|..|:
 Frog   636 Q--------------------------MDKIISELENEEKV-----LDEHIEK 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 1/1 (100%)
letm1XP_012821404.1 LETM1 155..415 CDD:369505
PTZ00121 <393..>629 CDD:173412 13/57 (23%)
PTZ00440 <568..>697 CDD:240419 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.