DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tbc1d15-17 and GAPsec

Sequence 1:NP_001259806.1 Gene:Tbc1d15-17 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster
Sequence 2:NP_648245.2 Gene:GAPsec FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster

Alignment Length:381 Identity:77/382 (20%)
Similarity:133/382 (35%) Gaps:119/382 (31%)


  Fly   360 DSARIKELIFRG-GVVQSLRPEVWKFLLNYY-----LWSDTHVERIERRKQ-------------- 404
            |..::::|.|.| ..|||.|...||.||.|.     .|:.|..::....||              
  Fly    23 DLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSN 87

  Fly   405 ---------KSIEYYNMKAQWLAMTTTQEA---NFCGYRERKCQIEKDVKRTDRSLQFF------ 451
                     ..::...:..|...::...|:   .|....|...||:|||:|....:.||      
  Fly    88 RASVDGGDGDKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDY 152

  Fly   452 --------AGEDNPNL----------------------------------------------TLL 462
                    .||....|                                              .::
  Fly   153 PCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVV 217

  Fly   463 QGILMTYVMYNFDLGYVQGMSDLLAPILEIQVN----------EVDTFWCFVGFM----ELVFTN 513
            |.||..|...|...||||||::::.||..:..:          |.|.|:||...|    :.....
  Fly   218 QRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKT 282

  Fly   514 FDIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNMYFCFRWLLVWYKRELNSEDVLKLWECL 578
            .|..:.|:|...|::..:::..:..::..:||.:....|:.||||.:...:|....|||::|:.:
  Fly   283 LDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSV 347

  Fly   579 WT---RLP-----CPNFHLLFSVAILDQE--TRVIIDSQY---EFTEILKHVNELS 621
            :.   |..     |.:..|:...|||:.:  :.|.:...|   :...::.|...|:
  Fly   348 FADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPPIDINVVIAHAGSLA 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 71/343 (21%)
GAPsecNP_648245.2 TBC <191..373 CDD:214540 40/182 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C22234965
eggNOG 1 0.900 E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22957
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.